KEGG   Clostridium ljungdahlii: CLJU_c01100Help
Entry
CLJU_c01100       CDS       T01276                                 

Definition
hydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
clj  Clostridium ljungdahlii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:clj00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
105172..106179
Genome map
AA seq 335 aa AA seqDB search
MLLEKLSNCIGPSGYEEEIRNVIKEELYTFTDNVTVDRMGNVIVHSDNNDNSSPKIMIAS
HMDERGLIITAYNDDGTLKFSTLGKMEKGALPCKTVLIGNKKVHGVIGIKPIHLQNKSER
DRNISYDDMCIDIGASSKDECRKTVSLGDFVVFDNSFSNFGDNLVKGKALDNRIGCSILL
ELLKEKYECNLYGVFYVQGNIDKRGIYTAAYNVKPDIMIDLDTINSTDGEGVPEYLKTNE
LTGGPVIPFNMEESIFNRDIVKSIRNKADNMGIAYKKSISTKDTSKLKPVRLPINNCKTA
AVLIPCKHMDYNISMCSLMDYESTLTLVKSYLSDL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
ttgcttttagaaaagctatctaactgtataggaccttctggttacgaagaagaaattaga
aatgtaataaaagaggagttgtacacttttactgataatgtaactgtagacagaatggga
aacgttatagtccatagtgataataatgataattcttcacctaaaataatgatagcttct
catatggatgagagaggtcttataattacagcttataatgatgatgggactctaaagttt
tcaactttaggtaaaatggaaaaaggagcattgccttgtaaaactgttttaattggaaac
aaaaaagtacatggtgttataggcataaaaccaatacatcttcagaataaaagtgaaagg
gatagaaatatatcttatgatgatatgtgtatagatattggagcctcaagtaaagatgag
tgtaggaaaactgtttcacttggagattttgtagtatttgacaatagtttttctaatttt
ggagacaatttggtaaaaggcaaggctttagataatagaataggatgttctatactttta
gaattattgaaggaaaaatatgagtgtaatttatatggagtgttttatgtccagggaaat
atagataaaagaggaatttatactgcagcttacaatgttaagcctgatataatgatagat
ttagatactataaatagtactgatggtgaaggcgtaccggaatatttaaaaacaaatgaa
cttacaggaggacccgttataccttttaatatggaagagtctatatttaatagagacatt
gtaaagtctattagaaataaggcagataatatgggaattgcttataaaaagagcataagt
actaaggatacaagtaaacttaaaccagtccgtttacctattaataactgcaagacagca
gcggtattaataccatgcaaacatatggattataatatttcaatgtgcagcttgatggat
tatgaaagtactttaactttggtaaaaagttatttgtcagatttatag

DBGET integrated database retrieval system