KEGG   Clostridium ljungdahlii: CLJU_c01110Help
Entry
CLJU_c01110       CDS       T01276                                 

Definition
(GenBank) predicted hydrolase
Organism
clj  Clostridium ljungdahlii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
106214..107173
Genome map
AA seq 319 aa AA seqDB search
MDKLLIKLINSFGVSGKEDEVREVIKERLNEINQDMYEDDIGNVIVKLGSGETKIMLCTH
MDSVGFIVNHIDDDGMIRVDNIGNFKKEDISHSFIRFDNGTLGKIYTSHEGEFVDIGVNE
REDALKKVNEGDMASLVGPYLSVGDNNVISPLLHNKVGCYILLKLIEYVKVENAELDFVF
ASQGEIGGIGARIAANNINPDYCIIVGTENATNAEERKNNINIDEGPVIKIMDSSLIMHK
DIKEMLENCAKRSEINLQYSISTGKSEGELVHKERIGIRTGEIAVPCRYKYSTSEMVSIN
DIEDTIKLLKQLENFKEII
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggataaacttctaataaaattaatcaattcttttggagttagtggtaaagaagatgaa
gtgagggaagtaataaaggaacgtttaaatgaaattaatcaagatatgtatgaagatgat
ataggtaatgtaatagtaaaattaggttctggtgaaactaaaataatgctgtgtactcat
atggattctgtaggatttatagtaaaccatatagacgatgatggcatgataagggtggac
aacataggaaattttaaaaaggaagatatatcccatagttttataaggtttgataatgga
accttaggaaaaatatatacttctcacgaaggcgaatttgtagatataggcgtgaatgaa
agggaagatgctttaaaaaaggtaaatgaaggtgatatggcatcccttgtaggaccgtat
ttaagtgtaggtgacaacaatgttataagcccacttttacataataaggtaggatgttat
atacttttaaagcttatagaatatgtaaaagtagaaaatgcagagcttgattttgtattt
gcatcacaaggtgaaataggaggaataggtgctagaattgctgcaaataatataaaccct
gattattgtataatagttggtactgaaaatgccacaaatgcggaggaaagaaaaaacaac
ataaatatagatgaaggaccagtaattaaaattatggatagttcacttataatgcataaa
gatataaaagagatgttagaaaattgtgctaagagatcagaaataaatttacaatacagc
ataagtacaggtaaatctgaaggggaattagtgcataaagagagaattggaataagaacc
ggagaaattgcagtaccatgtagatacaagtattccacatctgaaatggtatcaataaat
gatatagaagatactataaaattattaaagcaactggaaaactttaaagaaataatataa

DBGET integrated database retrieval system