KEGG   Clostridium ljungdahlii: CLJU_c03250Help
Entry
CLJU_c03250       CDS       T01276                                 

Gene name
pfk
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
clj  Clostridium ljungdahlii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLJU_c03250 (pfk)
   01230 Biosynthesis of amino acids
    CLJU_c03250 (pfk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLJU_c03250 (pfk)
   00030 Pentose phosphate pathway
    CLJU_c03250 (pfk)
   00051 Fructose and mannose metabolism
    CLJU_c03250 (pfk)
   00052 Galactose metabolism
    CLJU_c03250 (pfk)
  Energy metabolism
   00680 Methane metabolism
    CLJU_c03250 (pfk)
Enzymes [BR:clj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLJU_c03250 (pfk)
Protein phosphatases and associated proteins [BR:clj01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CLJU_c03250 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
336620..337576
Genome map
AA seq 318 aa AA seqDB search
MKTIAVLTSGGDAPGMNAAIRAVVRTALDKNLNVMGIKRGYSGLMNGEIVPMQRSSVADI
IQRGGTILKTARSKEFKTEEGRERAVNILKTFRIDGLVVIGGDGSFRGAHELSKLGIATI
GLPGTIDNDLAYTDFTIGFDTAVNTVLDAINKLRDTSTSHERVSIVEVMGRNCGDIALYS
GLAGGAENIILPEKGYDEQELCRSILEAKMKGKMHNLILLAEGIGGAEALAEKVENITGI
ETRATKLGHIQRGGSPTCSDRILASRFGYRAVELLEQGKSSRVVGIRNGKVVDLDIDEAL
SEPRRFDEKLYEIAYALA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatagctgtgttaacaagtggaggagatgctcctggaatgaatgctgctata
agggcagtagtgaggacagctctagataaaaacttaaacgtaatgggaattaaaagagga
tatagtggattaatgaatggcgaaatagtacccatgcagaggagtagtgttgcagacatt
atacaaagaggaggaactatattaaaaactgctagatctaaggaatttaaaacagaagag
ggaagagaaagagcagtaaatatattaaaaacatttagaatagatggattagtagttata
ggtggagatggatctttcaggggagcacatgaattatctaaattagggatagctactata
ggattacctggaactatagataatgatttggcatatacagattttaccataggatttgat
acagcagtaaataccgttttagatgctataaataagttaagagatacttctacctctcat
gaaagagtaagcattgtagaggttatgggaagaaattgtggagatatagctctttattct
ggacttgcaggtggagctgaaaatataattttacctgaaaaaggatatgatgaacaagaa
ttgtgtagaagtatattagaagcaaagatgaaaggaaaaatgcacaatttaatattactt
gcagaaggtattggtggagctgaagctttagctgagaaggttgagaatattaccggtata
gaaactagagctacaaaacttggacatattcaaagaggaggaagtcctacttgttcagat
agaattttagcttcaagatttggatatagagctgtcgaattgttagaacaaggcaaatct
tctagagttgttggaattagaaacggaaaggttgttgatttggatatagacgaggcacta
agtgagccaagaaggtttgacgaaaagctttatgagatagcttatgcgctagcgtaa

DBGET integrated database retrieval system