KEGG   Clostridium ljungdahlii: CLJU_c06340Help
Entry
CLJU_c06340       CDS       T01276                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
clj  Clostridium ljungdahlii
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:clj00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
697454..698272
Genome map
AA seq 272 aa AA seqDB search
MDKVITIGKKDFQIGKRTYIMGILNVTPDSFSDGGKFNNIELAIKHAKQMEEEGADIIDV
GGESTRPSYDPVSEQEELERVIPIIGKLSRCVDIPISIDTYKGKVAEESIKAGASLINDV
WGFKRDPYMAEVAAHYRVPCCLMHNRDNRNYTNLMNDVLNDLQESIDIALKAGVDPKNII
TDPGIGFAKDYEQNLAVMNQLERLSELGYPVLLGTSRKSMVGKALDLPVNERIEGTVATT
VIGIMKKCDFVRVHDVKENKRAAVMADAIIRR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggataaagtaattacaataggcaaaaaagattttcaaataggaaaaaggacttacatt
atgggtatacttaatgttacaccagattctttctctgatggcggaaaatttaacaatata
gagctggctataaaacatgctaaacagatggaggaagaaggggcagatataatagatgta
ggtggagaatctacaagaccaagctatgatcctgtatctgagcaggaagaactagaaaga
gttattccaataataggcaaattaagtaggtgtgtagacattcctatttctatagataca
tataagggaaaagttgcagaagaatctataaaagcaggagcatccttaataaatgatgtt
tggggatttaaaagagacccttatatggcagaagtagctgcacattatagagttccttgc
tgtttgatgcacaacagagataatagaaattatacaaatttgatgaatgacgtattaaat
gatttacaggaaagcatagatatagcgttaaaagctggagttgaccccaaaaatataata
acagatccaggcataggttttgctaaagattatgaacaaaatttagctgttatgaatcag
ttagaaaggctttcagaactaggatatccagtactcttaggaacttctagaaaatcaatg
gtaggaaaggcattagatctcccggtaaatgaaagaatagaaggaactgtagctactaca
gtaataggaataatgaaaaagtgtgattttgtaagggttcatgatgtaaaggaaaacaaa
agagctgcagtaatggcagatgcaataataagaaggtag

DBGET integrated database retrieval system