KEGG   Clostridium ljungdahlii: CLJU_c09410Help
Entry
CLJU_c09410       CDS       T01276                                 

Gene name
cheB
Definition
chemotaxis response regulator protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
clj  Clostridium ljungdahlii
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:clj02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:clj02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1051977..1053080
Genome map
AA seq 367 aa AA seqDB search
MEKIKVLVVDDSALMRKIISDMIGEDESIRVVGTARNGEDLLEKLSLNFTENSMPDVITL
DVEMPKMDGITALGELKKRNINIPVIVLSSVSKEGKQRTMECLDMGAFDFLPKPSGTISL
DINKVKTELVEKIKGAYLANTVKPNKAQENIQLSISKNEKASTLNVTSSNVDRKMKKDIN
AVVIGASTGGPKALYSVITQFPQNMGVPVFVVQHMPAGFTKAFADRLDSNSKIKVLEAED
GMNVEKNTVYVAPGGFHMEVWRDKRIHLNKEPAIWGVRPAVDKLFISASKVYGENIISVV
LTGMGRDGAQGTVEIKENGGITLSEDESTCTIYGMPKAAYATGKVDLVLPIDKIANEIVK
IIKFGGR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaattaaggttttagtagtagatgattctgcattaatgagaaaaattatttcg
gacatgataggtgaagatgaatctataagggttgtaggaactgctagaaatggggaagat
cttttagagaaactatcgttaaattttactgaaaatagtatgcctgatgtaataacttta
gatgtagaaatgccaaagatggatggaataacagcactaggcgaattgaaaaaaaggaat
attaatatacctgtaatagttttaagcagtgtctccaaggaaggaaaacagcgtacaatg
gaatgtcttgatatgggtgcttttgattttttacctaagccttcaggtacaatatctttg
gatataaataaagttaaaactgagcttgtagagaagataaaaggagcctacctggcaaat
acagttaaaccaaataaagcacaagaaaatatacaactgtctatatcaaaaaatgaaaaa
gcttccacattaaatgtcacaagttcaaatgtagatagaaaaatgaaaaaagatataaat
gcagtggtgataggagcatctacgggcggacctaaagcactttattcagttataacacaa
tttccccagaacatgggagtgccggtatttgtagtacagcatatgcctgcaggatttact
aaggcttttgcagacagattggattctaattcaaaaataaaagtattagaagcagaggat
ggtatgaatgttgaaaagaatactgtttatgtagcacctggtggatttcatatggaagta
tggagagataagagaatacatttgaacaaagaacctgccatttggggagtaaggcctgca
gtggataagctatttatatctgcatcaaaagtatatggagaaaatattataagtgtagtt
ttgacgggtatgggaagagatggagcacaaggaactgtagagataaaggaaaatggagga
attacactttctgaagatgaatcaacttgtactatttatggtatgcctaaagcagcttat
gccacaggaaaagtggacttagttttaccaatagacaaaatagcaaatgaaatagtaaaa
ataataaagtttggtgggaggtag

DBGET integrated database retrieval system