KEGG   Clostridium ljungdahlii: CLJU_c10570Help
Entry
CLJU_c10570       CDS       T01276                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
clj  Clostridium ljungdahlii
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:clj00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:clj00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1168915..1170363
Genome map
AA seq 482 aa AA seqDB search
MKLKKVMNGLTYEVVKGNDDLNIGEIQYDSREVKSGDVFVCIKGYVTDGHKYIDKAYKNG
AAAIVISEEVENVPDCTVIKVKDTRKALAIISSNYYDNPSKKMKIIGITGTNGKTTSTFM
MKSILETAGYKVGLVGTIANYIGEKKIPSHRTTPESLELQKLFKQMVDEGVQYCVMEVSS
HSLYLDRAYGVRFSEAIFTNLTRDHLDFHKTFENYYKAKLILFKNTINSVINIDDKYGDK
VYEDALGTKITYAINKEADLKANDLNIHSRGANFNITYRGQTAHINLNIPGKYNVMNALG
SIGACLCEGISLEVVKKGLESMNAVPGRCEIVTKGYNLGYEVIVDYAHTPDGLENILKTA
REFTTGRLIAVFGCGGDRDNTKRPIMGKIGTELSDFAVITSDNPRGEEPRAIIDEIVNGV
EKDDYKVVENRKEAIKEAIHMAQKGDVIVVAGKGHEDYQILKDKTIHFDEREIIAEILDN
AQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgaagaaagtgatgaacggacttacatatgaagttgttaagggaaatgatgat
ttaaatataggagaaattcaatatgattctagagaagtcaaatctggagatgtttttgta
tgtataaaggggtatgttacggatggacataaatacatagataaggcttataaaaatggt
gcagcagccattgtaataagcgaagaagtagaaaatgtacccgattgtactgtgataaag
gtaaaggatacaagaaaagcacttgctattatttcatcaaattactatgataatccttct
aaaaagatgaaaataataggaataacgggaactaacggtaaaactacatctacatttatg
atgaaatccatactagaaacagcaggttataaagtaggacttgtaggtactatagcaaat
tatataggagaaaagaaaataccttctcataggactactcctgaatctttagaacttcag
aagttatttaaacagatggtggatgaaggagttcagtattgtgttatggaagtatcttct
cattcactgtacttagatagagcatacggagtgagattttcagaggcaatatttacaaat
ctaacgagggatcacttagattttcacaagacctttgaaaattattataaggctaaatta
atattatttaaaaatactattaattctgttataaatatagacgacaaatatggagataaa
gtatatgaagatgcattaggaaccaagataacctatgctataaataaggaagctgattta
aaagctaatgatttaaatatacattccagaggagctaattttaatataacatataggggg
cagacagcgcatataaatttaaatataccaggtaaatataatgtgatgaatgctcttgga
agtataggggcatgtctttgcgaaggtataagtttagaagttgtgaaaaagggacttgaa
tctatgaatgctgtacctggaagatgtgaaatagttactaaagggtataaccttggatat
gaagttatagtagactatgcccatactccagatgggttggagaacatattaaaaactgct
agagaatttactacaggaagacttatagctgtctttggatgtgggggagacagggataat
actaaaaggcctataatgggtaagataggtacagagttatctgattttgcagttataact
tcagataatccaagaggagaagagcctagggcaataattgatgaaatagtaaatggtgtt
gaaaaagatgattacaaggtagttgaaaataggaaagaagctataaaggaagctatacat
atggcacaaaaaggtgatgtaattgtggttgcaggaaaggggcatgaagattatcagata
ttaaaagataagaccatacattttgatgaaagagagataatagctgaaattttagacaat
gcacagtga

DBGET integrated database retrieval system