KEGG   Clostridium ljungdahlii: CLJU_c11960Help
Entry
CLJU_c11960       CDS       T01276                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.-)
Orthology
K00132  
acetaldehyde dehydrogenase (acetylating) [EC:1.2.1.10]
Organism
clj  Clostridium ljungdahlii
Pathway
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLJU_c11960
   00650 Butanoate metabolism
    CLJU_c11960
Enzymes [BR:clj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CLJU_c11960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1295679..1297232
Genome map
AA seq 517 aa AA seqDB search
MENFDKDLRSIQEARDLARLGKIAADQIADYTEEQIDKILCNMVRVAEENAVCLGKMAAE
ETGFGKAEDKAYKNHMAATTVYNYIKDMKTIGVIKEDKSEGVIEFAEPVGLLMGIVPSTN
PTSTVIYKSIIAIKSRNAIVFSPHPAALKCSTKAIELMRDAAVAAGAPANVIGGIVTPSI
QATNELMKAKEVAMIIATGGPGMVKAAYSSGTPAIGVGAGNSPSYIERTADVHQSVKDII
ASKSFDYGTICASEQSVIAEECNHDEIVAEFKKQGGYFMTAEETAKVCSVLFKPGTHSMS
AKFVGRAPQVIAEAAGFTVPEGTKVLIGEQGGVGNGYPLSYEKLTTVLAFYTVKDWHEAC
ELSIRLLQNGLGHTMNIHTNDRDLVMKFAKKPASRILVNTGGSQGGTGASTGLAPAFTLG
CGTWGGSSVSENVTPLHLINIKRVAYGLKDCTTLAADDTTFNHPELCGSKNDLGFCATSP
AEFAAKSNCDSTAADTTDNDKLARLVSELVAAMKGAN
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaattttgataaagacttacgttctatacaagaagcaagagatcttgcacgttta
ggaaaaattgcagcagaccaaattgctgattatactgaagaacaaattgataaaatccta
tgtaatatggttagggtagcagaagaaaatgcagtttgccttggtaaaatggctgcagaa
gaaactggttttggaaaagctgaagataaggcttataagaaccatatggctgctactaca
gtatataattacatcaaggatatgaagactattggtgttataaaagaagataaaagtgaa
ggtgtaattgaatttgcagaaccagttggtttattaatgggtattgtaccatctacaaat
ccaacatctactgttatttataaatcaatcattgcaattaaatcaagaaatgcaattgta
ttctcaccacacccagctgcattaaaatgttcaacaaaagcaatagaacttatgcgtgat
gcagcagtagcagcaggagctcctgcaaatgtaattggtggtattgttacaccatctata
caagctacaaatgaacttatgaaagctaaagaagttgctatgataattgcaactggaggc
cctggaatggtaaaggctgcatatagttcaggaacacctgcaataggcgttggtgctggt
aactctccatcctatattgaaagaactgctgatgttcatcaatcagttaaagatataata
gctagtaagagttttgactatggtactatttgtgcatccgagcagtctgtaattgcagaa
gaatgcaaccatgatgaaatagtagctgaatttaagaaacaaggcggatatttcatgaca
gctgaagaaactgcaaaagtttgcagcgtactttttaaacctggtacacacagcatgagc
gctaagtttgtaggaagagctcctcaggttatagcagaagctgcaggtttcacagttcca
gaaggaacaaaagtattaataggagaacaaggcggagttggtaatggttaccctctatct
tatgagaaacttacaacagtacttgctttctatacagttaaagattggcatgaagcatgt
gagcttagtataagattacttcaaaatggtcttggacatacaatgaacattcatacaaat
gatagagacttagtaatgaagtttgctaaaaaaccagcatcccgtatcttagttaatact
ggtggaagccagggaggtactggtgcaagcacaggattagcacctgcatttacattaggt
tgtggtacatggggaggaagctctgtttctgaaaatgttactccattacatttaatcaat
ataaagagagtagcatatggtcttaaagattgtactacattagctgcagacgatacaact
ttcaatcatcctgaactttgcggaagcaaaaatgacttaggattctgtgctacaagccct
gcagaatttgcagcaaagagcaattgtgatagcactgctgcagatactactgataatgat
aaacttgctagactcgtaagtgaattagtagctgcaatgaagggagctaactaa

DBGET integrated database retrieval system