KEGG   Clostridium ljungdahlii: CLJU_c11960Help
Entry
CLJU_c11960       CDS       T01276                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.-)
Orthology
K00132  
acetaldehyde dehydrogenase (acetylating) [EC:1.2.1.10]
Organism
clj  Clostridium ljungdahlii
Pathway
Benzoate degradation
Pyruvate metabolism
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:clj00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:clj00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:clj00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:clj00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1295679..1297232
Genome map
AA seq 517 aa AA seqDB search
MENFDKDLRSIQEARDLARLGKIAADQIADYTEEQIDKILCNMVRVAEENAVCLGKMAAE
ETGFGKAEDKAYKNHMAATTVYNYIKDMKTIGVIKEDKSEGVIEFAEPVGLLMGIVPSTN
PTSTVIYKSIIAIKSRNAIVFSPHPAALKCSTKAIELMRDAAVAAGAPANVIGGIVTPSI
QATNELMKAKEVAMIIATGGPGMVKAAYSSGTPAIGVGAGNSPSYIERTADVHQSVKDII
ASKSFDYGTICASEQSVIAEECNHDEIVAEFKKQGGYFMTAEETAKVCSVLFKPGTHSMS
AKFVGRAPQVIAEAAGFTVPEGTKVLIGEQGGVGNGYPLSYEKLTTVLAFYTVKDWHEAC
ELSIRLLQNGLGHTMNIHTNDRDLVMKFAKKPASRILVNTGGSQGGTGASTGLAPAFTLG
CGTWGGSSVSENVTPLHLINIKRVAYGLKDCTTLAADDTTFNHPELCGSKNDLGFCATSP
AEFAAKSNCDSTAADTTDNDKLARLVSELVAAMKGAN
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaattttgataaagacttacgttctatacaagaagcaagagatcttgcacgttta
ggaaaaattgcagcagaccaaattgctgattatactgaagaacaaattgataaaatccta
tgtaatatggttagggtagcagaagaaaatgcagtttgccttggtaaaatggctgcagaa
gaaactggttttggaaaagctgaagataaggcttataagaaccatatggctgctactaca
gtatataattacatcaaggatatgaagactattggtgttataaaagaagataaaagtgaa
ggtgtaattgaatttgcagaaccagttggtttattaatgggtattgtaccatctacaaat
ccaacatctactgttatttataaatcaatcattgcaattaaatcaagaaatgcaattgta
ttctcaccacacccagctgcattaaaatgttcaacaaaagcaatagaacttatgcgtgat
gcagcagtagcagcaggagctcctgcaaatgtaattggtggtattgttacaccatctata
caagctacaaatgaacttatgaaagctaaagaagttgctatgataattgcaactggaggc
cctggaatggtaaaggctgcatatagttcaggaacacctgcaataggcgttggtgctggt
aactctccatcctatattgaaagaactgctgatgttcatcaatcagttaaagatataata
gctagtaagagttttgactatggtactatttgtgcatccgagcagtctgtaattgcagaa
gaatgcaaccatgatgaaatagtagctgaatttaagaaacaaggcggatatttcatgaca
gctgaagaaactgcaaaagtttgcagcgtactttttaaacctggtacacacagcatgagc
gctaagtttgtaggaagagctcctcaggttatagcagaagctgcaggtttcacagttcca
gaaggaacaaaagtattaataggagaacaaggcggagttggtaatggttaccctctatct
tatgagaaacttacaacagtacttgctttctatacagttaaagattggcatgaagcatgt
gagcttagtataagattacttcaaaatggtcttggacatacaatgaacattcatacaaat
gatagagacttagtaatgaagtttgctaaaaaaccagcatcccgtatcttagttaatact
ggtggaagccagggaggtactggtgcaagcacaggattagcacctgcatttacattaggt
tgtggtacatggggaggaagctctgtttctgaaaatgttactccattacatttaatcaat
ataaagagagtagcatatggtcttaaagattgtactacattagctgcagacgatacaact
ttcaatcatcctgaactttgcggaagcaaaaatgacttaggattctgtgctacaagccct
gcagaatttgcagcaaagagcaattgtgatagcactgctgcagatactactgataatgat
aaacttgctagactcgtaagtgaattagtagctgcaatgaagggagctaactaa

DBGET integrated database retrieval system