KEGG   Clostridium ljungdahlii: CLJU_c12520Help
Entry
CLJU_c12520       CDS       T01276                                 

Gene name
gpk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
clj  Clostridium ljungdahlii
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CLJU_c12520 (gpk)
Enzymes [BR:clj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CLJU_c12520 (gpk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1352683..1353300
Genome map
AA seq 205 aa AA seqDB search
MSRKGLLIVISGPSGTGKGTVCKALLKKNDFWISTSATTRSPRKGEVDGVNYYFLTEETF
KDKIKNKDFLEYAKVYENYYGTPKSQVLKAIDEGKDVVLEIDIQGALKVKESYPEGVFIF
ILPPSMKELKNRIIGRGSETPESLNLRFKSAYKEINYVSKYNYAVINDTVDNAVENIESI
ITAEKCRVDRIKDEILNSKEGILYE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagaaaaggattgctaattgtcatatcaggaccttctggaactggaaaaggtaca
gtttgcaaggcattgctgaaaaaaaatgatttttggatttctacttcagctactactagg
tctccaagaaaaggggaggtagatggagtaaattattattttttgaccgaggagactttt
aaggacaaaataaaaaataaggattttttagagtatgctaaagtttatgaaaactattat
ggtacacctaagtctcaagttttgaaagctatagatgaaggaaaagatgtagtgcttgaa
attgatattcagggagccttaaaggtaaaagaaagctatccagaaggggtgtttatattt
atacttccgccttcaatgaaagaacttaaaaacaggattataggtaggggaagtgaaaca
cctgagtccttgaatctaagatttaagtcagcttataaggaaataaattatgtttcaaaa
tataattatgcggttataaacgatactgtagacaatgcagtggaaaatatagagagcatt
attacagctgaaaaatgtagagtagataggattaaagatgaaatattaaattctaaggag
ggtattttatatgaataa

DBGET integrated database retrieval system