KEGG   Clostridium ljungdahlii: CLJU_c16100Help
Entry
CLJU_c16100       CDS       T01276                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
clj  Clostridium ljungdahlii
Pathway
clj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
clj01100  Metabolic pathways
clj01110  Biosynthesis of secondary metabolites
clj01130  Biosynthesis of antibiotics
clj01230  Biosynthesis of amino acids
Module
clj_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CLJU_c16100 (trpC)
Enzymes [BR:clj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CLJU_c16100 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE QRPTase_C Amidase_3 FMN_dh
Motif
Other DBs
NCBI-ProteinID: ADK14674
UniProt: D8GTM5
Position
1749745..1750521
Genome map
AA seq 258 aa AA seqDB search
MILDEIVKAKRPQLELEKQNMPLTKIIEECSGKVTRDFKKVLGKEEISIIAEIKKASPSK
GIIVEDFDPVGIAKIYESIDIDAVSVLTEKNFFKGSDKYISKVKGVNSKPILRKDFIIDT
YQIYQSKFIGADAILLITAILKDKLKDYYNLAQSIGLQCLVEVHDEEELEIALEAGCSIV
GINNRNLKDFTEDLKNTERIIKKIPEKVLVVSESAIKAPEDIRYLKELGVNAVLIGETFM
RNIKDEYKLRDFIKQSKF
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgatacttgatgaaatagtgaaagctaaaagacctcaattggaacttgaaaaacaaaat
atgcctcttactaagataatagaagaatgcagtggaaaggttacaagagattttaaaaaa
gtacttggcaaagaagaaatatctatcattgcagagataaagaaagcatcaccttcaaaa
ggtattattgtagaagattttgatcctgtcggcatagccaaaatatatgaaagcatagat
atagatgcagtgtctgtacttacagaaaaaaatttttttaagggaagtgataaatacata
agcaaagtaaaaggggtaaattcaaagcccattttgagaaaggattttataattgatacc
tatcaaatataccaatccaaatttataggtgcagatgctattttgcttataacagccatc
ttaaaagataaattaaaagattattacaacttagcacaaagtattggacttcaatgtctg
gtggaagtccatgatgaagaggaacttgaaattgcacttgaagctggatgttccattgta
ggaattaacaatagaaacttaaaagattttacagaagacttgaaaaatacagaaagaatt
ataaagaaaataccagagaaagttttagtagtttctgaaagtgctataaaagctccagaa
gatataagatatttaaaggaattaggtgtaaatgcagtgcttataggagaaacttttatg
agaaatattaaagatgagtacaaattaagagattttataaaacagtctaagttttga

DBGET integrated database retrieval system