KEGG   Clostridium ljungdahlii: CLJU_c16130Help
Entry
CLJU_c16130       CDS       T01276                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
clj  Clostridium ljungdahlii
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLJU_c16130 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLJU_c16130 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CLJU_c16130 (trpA)
Enzymes [BR:clj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CLJU_c16130 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1752339..1753124
Genome map
AA seq 261 aa AA seqDB search
MNRIDLKFSKLKERGEKALIPFITSGDPDLDTTFELVIAMEEAGADIIELGIPYSDPLAD
GPTIQASSNRSLKGGTKIAGIMDTVKKIREKTEVPLVYLVYYNSIFKYGMEKFIRECSQC
GVDGIIIPDLPIEERKDIAAIGKEYNVHLIPLVAPTSKERIEKIVKDAGGFIYCVSVNGV
TGTRSSINTDIEEYMNIISSYTNVPKALGFGISSAEMAAKFKPYCEGIIVGSAVIKKIEA
GKSKDDIIKNVKKFIKELKLA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaatagatttaaagttttcaaagctaaaagaaagaggagaaaaagctctaata
ccgtttataacttccggagatccagatttagacactactttcgaattagtaattgcaatg
gaagaagcaggagcagatataatagaacttggaataccctattcagatcctctggcagat
ggacctactatacaggcatcttcaaatagatcccttaaaggcggaacgaaaatagcaggt
ataatggatacggtgaaaaagataagggaaaaaacagaagtacctcttgtgtatcttgtc
tactataactccatattcaagtatggtatggaaaagtttataagagagtgcagccagtgc
ggcgtagacggaattataataccagatcttcctatagaagagagaaaggacattgcagcc
attggaaaagaatataatgtacaccttattccactagtagcacctacttcaaaggagaga
atagaaaagatagtaaaagatgcggggggatttatatattgtgtctctgtaaatggtgtt
acaggtacaagaagcagcataaatactgatattgaggaatatatgaatataatttcaagt
tatacgaatgttccaaaggcacttggatttggaatatcctcagcagaaatggctgcaaaa
ttcaagccttattgtgaagggataattgtgggaagtgcagtaattaaaaagatagaagct
ggaaaaagtaaagatgatataattaaaaatgtaaaaaagtttattaaagaattaaaatta
gcttag

DBGET integrated database retrieval system