KEGG   Clostridium ljungdahlii: CLJU_c16510Help
Entry
CLJU_c16510       CDS       T01276                                 

Gene name
adhE1
Definition
bifunctional aldehyde/alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
clj  Clostridium ljungdahlii
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CLJU_c16510 (adhE1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLJU_c16510 (adhE1)
   00620 Pyruvate metabolism
    CLJU_c16510 (adhE1)
   00650 Butanoate metabolism
    CLJU_c16510 (adhE1)
  Lipid metabolism
   00071 Fatty acid degradation
    CLJU_c16510 (adhE1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    CLJU_c16510 (adhE1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CLJU_c16510 (adhE1)
   00626 Naphthalene degradation
    CLJU_c16510 (adhE1)
Enzymes [BR:clj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CLJU_c16510 (adhE1)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CLJU_c16510 (adhE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1791269..1793881
Genome map
AA seq 870 aa AA seqDB search
MKVTNVEELMKRLEEIKDAQKKFATYTQEQVDEIFRQAAMAANSARIELAKMAVEESGMG
IVEDKVIKNHFASEYIYNKYKDEKTCGVLERDAGFGIVRIAEPVGVIAAVVPTTNPTSTA
IFKSLIALKTRNGIIFSPHPRAKKSTIAAAKIVLDAAVKAGAPEGIIGWIDEPSIELSQV
VMGEANLILATGGPGMVKAAYSSGKPAVGVGPGNTPAVIDESADIKMAVNSILLSKTFDN
GMICASEQSVIVLDSIYEEVKKEFAYRGAYILSKDETDKVGKIILKNGALNAGIVGQPAF
KIAQLAGVDVPEKAKVLIGEVESVELEEPFSHEKLSPVLAMYRARNFEDAIAKTDKLVRS
GGFGHTSSLYVNPMTEKAKVEKFSTMMKTSRTIINTPSSQGGIGDIYNFKLAPSLTLGCG
SWGGNSVSENVGPKHLLNIKSVAERRENMLWFRVPEKVYFKYGSLGVALKELKVMNKKKV
FIVTDKVLYQLGYVDKVTKVLEELKISYKVFTDVEPDPTLATAKKGAAELLSYEPDTIIS
VGGGSAMDAAKIMWVMYEHPEVKFEDLAMRFMDIRKRVYVFPKMGEKAMMISVATSAGTG
SEVTPFAVITDEKTGAKYPLADYELTPDMAIVDAELMMGMPRGLTAASGIDALTHALEAY
VSIMATEFTNGLALEAVKLIFEYLPKAYTEGTTNVKAREKMVHASCIAGMAFANAFLGVC
HSMAHKLGAQHHIPHGIANALMIDEVIKFNAVDDPIKQAAFPQYEYPNARYRYAQIADCL
NLGGNTEEEKVQLLINAIDDLKAKLNIPETIKEAGVSEDKFYATLDKMSELAFDDQCTGA
NPRYPLISEIKQMYINVFDKTEPIVEDEEK
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttacaaacgtagaagaactaatgaaaagactagaagaaataaaggatgctcaa
aagaaatttgctacatatactcaagaacaagtggatgaaatttttagacaagcagctatg
gcagctaatagtgctagaatagaactagctaaaatggcagtagaagaaagcggaatggga
attgtagaagacaaggtcattaaaaatcactttgcctcagaatatatatataacaaatat
aaggatgaaaaaacctgtggagttttagagagagatgcaggatttggtatagttagaatt
gcggaacctgtaggagttatcgcagcagtagttccaacaactaatccaacatctacagca
atatttaaatcactaatagctttaaaaactagaaatggtataattttttcaccccatcca
agggcaaagaaatcaactattgcagcagctaaaatagtacttgacgctgcagttaaagct
ggtgctcctgaaggaattataggatggatagatgaaccttccattgaactttcacaggtg
gtaatgggagaagcaaatttaattcttgcaactggtggcccgggtatggttaaggctgcc
tattcttcaggcaaacctgctgtgggagttggtccaggtaacacacctgctgtaattgat
gaaagtgccgacattaaaatggcagtaaattcaatattactatcaaagacttttgataat
ggtatgatttgtgcctcagagcagtcagtaatagttttagactcaatatatgaggaagtt
aaaaaagaatttgcttataggggtgcttatatattaagtaaggatgaaacagataaggtt
ggaaaaataattttaaaaaatggagccttaaatgcaggtattgtaggacaacctgctttt
aaaatagcacagctggcaggagtggatgtaccagaaaaagctaaagtacttataggagag
gtagaatcggtagaacttgaagaaccattttctcatgaaaagttatctccagttttagct
atgtacagggcaagaaattttgaggatgccattgcaaaaactgataaactggttaggtca
ggtggatttggacatacatcttcattatatgtaaatccaatgacagagaaagcaaaagta
gaaaaatttagtactatgatgaaaacatcaagaactataattaacacaccttcatcccaa
ggtggtataggtgatatatataactttaaactagctccttctttgacattaggctgcggt
tcctggggaggaaattctgtatccgaaaatgttgggcctaaacatttattaaacataaaa
agtgttgctgagaggagagaaaatatgctttggtttagagtacctgaaaaggtttatttc
aaatatggtagtcttggagttgcattaaaagaattaaaagttatgaataagaagaaagta
tttatagtaacagataaagttctttatcaattaggttatgtggacaaagttacaaaagtt
cttgaggaactaaaaatttcctataaggtatttacagatgtagaaccagatccaaccctt
gctacagctaaaaaaggtgcagcagaactgctttcctatgaaccggatacaattatatca
gttggtggtggctcagcaatggatgcagctaagatcatgtgggtaatgtatgagcatcca
gaagtaaaatttgaagatttagctatgagatttatggatataagaaagagagtatatgtt
ttccctaagatgggagaaaaggcaatgatgatttcagtagcaacatccgcaggaacaggg
tcggaagttactccatttgcagtaatcactgatgaaaaaacaggagctaaatatccatta
gctgattatgaactaactccagacatggctatagttgatgcagaacttatgatgggaatg
ccaagaggacttacagcagcttcgggtatagatgcattaacccatgcactggaggcatat
gtgtcaataatggctacagaatttaccaatggattagcccttgaagcagtaaagttgata
tttgaatatttaccaaaagcttatacagaaggtacaactaatgtaaaggcaagagaaaag
atggttcatgcttcatgtattgcaggtatggcctttgcaaatgcatttttaggggtatgc
cactctatggcacataaattgggagcacagcatcacataccacatggaattgccaatgca
cttatgatagatgaagttataaaattcaatgctgtagatgatccaataaaacaagctgca
tttccccaatacgagtatccaaatgctaggtatagatatgctcagatagctgattgtctg
aacttgggaggaaatacagaagaggaaaaggtacaactattaataaatgctatagatgat
ttaaaagctaagttaaatattccagaaactataaaagaagcaggagtttcagaagataaa
ttctatgctactttagataaaatgtcagaattagcttttgatgatcagtgtacaggagct
aatccaagatatccactgataagtgaaataaaacaaatgtatataaatgtttttgataaa
accgaaccaattgtagaagatgaagaaaagtaa

DBGET integrated database retrieval system