KEGG   Clostridium ljungdahlii: CLJU_c17710Help
Entry
CLJU_c17710       CDS       T01276                                 

Gene name
asn
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
clj  Clostridium ljungdahlii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CLJU_c17710 (asn)
Enzymes [BR:clj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CLJU_c17710 (asn)
Peptidases [BR:clj01002]
 Cysteine Peptidases
  Family C44
   CLJU_c17710 (asn)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1917884..1919473
Genome map
AA seq 529 aa AA seqDB search
MCTIMCYTGTDMKHEKFAEALQRTESRGPDMTEILTLPSGILGFQRLSIMDLSFSGMQPF
TRKTDAAICNGEIYGFRKIKEELIKKGHKFISDSDCEILLPMYYEYGLDMFSKLDAEFAT
IIYDGKKDRYIAARDPIGIRPLFYGYSSSGKIMFASEAKNLVGLTYKIMSFPPGHYYADG
KFTCYCDIAATESDYCKDDLETICSNIHDKLVAGVEKRMDADAPVGFLLSGGLDSSLVCA
IAQKMNPEKPIKTFAIGMTEDAIDLKYAKEVADYIHSDHTVVYMTKEEVIESLDEVIKIL
GTYDITTIRASMGMYLICKKIHEISDVRVLLTGEISDELFGYKYTDFAPNAEEFQKESQK
RIRELYMYDVLRADRCISSNSLEARVPFGDLDFVKYVMSIDPEKKLNKYNMGKYLLRHSF
EGDYLPHDILYREKAAFSDAVGHSMVDYLKEYAETYYSDEEFEKLCKKYEYHVEPFTKES
LLYREIFEKYYPGQADMIVDFWMPNKEWEGCNVNDPSARVLSNYGASGK
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtgtacaattatgtgctatacaggaacggatatgaaacatgaaaaatttgcagaggca
ttgcagagaactgagtccagaggaccggatatgacggaaattcttactttgccatctggt
attttgggttttcaaagactttctattatggatttaagttttagcggaatgcagccattc
acaagaaaaacagatgcagctatctgtaatggtgaaatttatggctttcgcaaaattaaa
gaagaactaataaaaaaagggcataagtttatttctgacagtgattgtgaaatattactt
cctatgtactatgaatatggactagatatgttttcaaagctagatgcagaatttgcaact
attatatatgatggaaaaaaggacagatatattgcagcacgagatccaattggaattcgt
cctttattttatggctattcttcatcaggtaagatcatgtttgcaagtgaagctaaaaac
ttggttggtcttacatataaaattatgtcatttccaccaggacattactatgctgatggt
aaatttacgtgttattgtgatatagcagcaacagaaagtgattactgcaaggatgattta
gaaactatttgcagcaatattcatgataaattggtagcaggtgtagaaaaacgtatggat
gctgatgctcctgtaggattcttgttaagcggtggtttagatagttcactcgtatgtgca
attgctcagaaaatgaatcctgaaaaaccaattaaaacatttgctataggtatgactgaa
gatgcaattgatttaaaatatgcaaaagaagttgcagattacattcatagtgatcatact
gttgtttatatgacaaaagaagaagtaattgaatcacttgatgaggttattaaaattctt
ggaacatacgatattaccacaataagagcaagtatgggaatgtatttgatttgcaagaaa
atacatgagatttctgatgtcagagtgcttctcactggtgaaatttctgatgaattattt
ggctataaatatactgattttgctccaaatgcagaagaatttcaaaaggaatcacagaag
agaattcgagagctttatatgtacgatgtacttcgtgcagaccgttgtataagctcaaat
tctttagaagcaagagtaccatttggtgatttggattttgtaaaatatgttatgtccatt
gacccagaaaagaaattaaacaaatacaacatgggtaagtaccttttgagacattcattt
gaaggcgattacttgccacatgatattttgtatcgtgaaaaagcagcatttagtgatgct
gtagggcattctatggtagattatttaaaggaatatgcagaaacatattattctgatgaa
gaatttgaaaagctatgtaaaaaatatgaatatcatgttgaaccatttacaaaagaatca
ttgctatatagagaaatttttgaaaaatattatccaggacaagcagatatgatagtagac
ttttggatgccaaacaaagaatgggaaggctgtaacgtaaacgaccctagtgctagagta
ttatcaaattatggtgctagtggtaaataa

DBGET integrated database retrieval system