KEGG   Clostridium ljungdahlii: CLJU_c18240Help
Entry
CLJU_c18240       CDS       T01276                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
clj  Clostridium ljungdahlii
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CLJU_c18240
   00051 Fructose and mannose metabolism
    CLJU_c18240
Enzymes [BR:clj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     CLJU_c18240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1975969..1977291
Genome map
AA seq 440 aa AA seqDB search
MKEYFNNVSKINYEGPDSKNPYSFKYYNPDEVIGGKKMRDHLRFSMSYWHTLTANGTDQF
GSGTMVRPWDNVNDKMELAKARMEAAFEFMNKLDIDYFCFHDRDIAPEGKDLAETNKNLD
EIVAMCKDLMKKNNKKLLWGTANLFNNPRFVHGAGTTCNANVYAYSAAQLKKAIEVTNEL
GGENYVFWGGREGYETLLNTDMGFEMDNFARILQMAVDYAKKIGFKGQFLIEPKPKEPTK
HQYDFDVATVLGFLRKYKLEDYFKINIEANHATLAGHTFQHEICLARNNNALGSLDANQG
DPHLGWDTDQFPTNVYDTTLSMYEVLKNGGIAPGGLNFDAKVRRASFEPEDLFLAYIAGM
DSFAKGLRVAYKLLQDAPIENFIKERYSSFSTGIGKDIVDGKVGFDELEKYALENNVINN
KSGRQEYLESVVNQYILEDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagtactttaataatgtatctaaaataaattatgaaggaccggattcgaaaaat
ccttactcgtttaaatattataatcctgatgaagtaattggcggaaaaaagatgagagat
catttaagattttcaatgtcttactggcatacgttaactgctaatggaactgatcagttt
ggatcaggaacaatggttaggccatgggataatgtaaacgataaaatggagcttgctaaa
gcaagaatggaagcagcatttgaatttatgaacaagctagatatagattatttttgcttt
catgatagagatatagcacctgaaggaaaagaccttgcagaaacaaataaaaatttagat
gaaatagtagcaatgtgtaaggacttaatgaaaaagaacaataaaaagttattatggggt
acggctaacttatttaataatccaagatttgtacatggtgctggaactacatgtaatgcg
aatgtttatgcttattcagcagcacagctaaaaaaagcaatagaagttacaaatgaatta
ggtggagaaaactatgtattttggggtggaagagaaggatatgaaacacttctaaatact
gacatgggatttgaaatggacaactttgctagaatactacagatggcagtagattatgca
aagaaaataggatttaaaggacaatttcttatagaaccaaagccaaaggagcctacaaaa
catcagtatgattttgatgtagcaactgttttaggatttttaagaaagtacaagctagaa
gattacttcaagataaatattgaagcaaatcatgctactttagcaggacatactttccag
catgaaatatgcctagcaagaaataataatgcacttggaagcttagatgcaaaccaggga
gatccacatcttggatgggatacagatcaatttcctacaaatgtatacgatacaacatta
tcaatgtacgaagtacttaaaaatggcggtatagcaccaggaggattgaactttgatgca
aaggtaagaagagcatcttttgaaccagaagatttattcttagcatatatagcaggaatg
gatagtttcgctaaaggacttagagttgcatataaattattacaagatgctcctattgaa
aactttattaaagaaagatattcaagcttttctacaggaataggtaaagacatagtagat
ggcaaagtaggatttgatgaattagaaaaatatgctttagaaaataatgttataaataat
aaatcaggaagacaagaatatttagaatcagtagtaaatcaatatatacttgaggataaa
tag

DBGET integrated database retrieval system