KEGG   Clostridium ljungdahlii: CLJU_c20210Help
Entry
CLJU_c20210       CDS       T01276                                 

Definition
tungsten-containing aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
clj  Clostridium ljungdahlii
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLJU_c20210
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CLJU_c20210
Enzymes [BR:clj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CLJU_c20210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2192715..2194538
Genome map
AA seq 607 aa AA seqDB search
MYGYKGKVLRINLSSKTYIVEELKIDKAKKFIGARGLGVKTLFDEVDPKVDPLSPDNKFI
IAAGPLTGAPVPTSGRFMVVTKSPLTGTIAIANSGGKWGAEFKAAGYDMIIVEGKSDKEV
YVNIVDDKVEFRDASHVWGKLTEETTKMLQQETDSRAKVLCIGPAGEKLSLMAAVMNDVD
RTAGRGGVGAVMGSKNLKAIVVKGSGKVKLFDEQKVKEVALEKTNILRKDPVAGGGLPTY
GTAVLVNIINENGVHPVKNFQKSYTDQADKISGETLTKDCLVRKNPCYRCPIACGRWVKL
DDGTECGGPEYETLWSFGSDCDVYDINAVNTANMLCNEYGLDTITAGCTIAAAMELYQRG
YIKDEEIAADGLSLNWGDAKSMVEWVKKMGLREGFGDKMADGSYRLCDSYGVPEYSMTVK
KQELPAYDPRGIQGHGITYAVNNRGGCHIKGYMVSPEILGYPEKLDRLAVEGKAGYARVF
HDLTAVIDSLGLCIFTTFGLGAQDYVDMYNAVVGGELHDVNSLMLAGDRIWTLEKIFNLK
AGIDSSQDTLPKRLLEEQIPEGPSKGEVHKLDVLLPEYYSVRGWDKNGIPTEETLKKLGL
DEYVGKL
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtacggatataagggtaaggtattaagaattaatctaagtagtaaaacttatatagtg
gaagaattgaaaattgacaaagctaaaaaatttataggtgcaagagggttaggcgtaaaa
accttatttgacgaagtagatccaaaggtagatccattatcacctgataacaaatttatt
atagcagcgggaccacttacaggtgcacctgttccaacaagcggaagattcatggtagtt
actaaatcacctttaacaggaactattgctattgcaaattcaggtggaaaatggggagca
gaattcaaagcagctggatacgatatgataatcgttgaaggtaaatctgataaagaagtt
tatgtaaatatagtagatgataaagtagaatttagggatgcttctcatgtttggggaaaa
ctaacagaagaaactacaaaaatgcttcaacaggaaacagattcgagagctaaggtttta
tgcataggaccagctggggaaaagttatcacttatggcagcagttatgaatgatgttgat
agaacagcaggacgtggtggtgttggagctgttatgggttcaaagaacttaaaagctatt
gtagttaaaggaagcggaaaagtaaaattatttgatgaacaaaaagtgaaggaagtagca
cttgagaaaacaaatattttaagaaaagatccagtagctggtggaggacttccaacatac
ggaacagctgtacttgttaatattataaatgaaaatggtgtacatccagtaaagaatttt
caaaaatcttatacagatcaagcagataagatcagtggagaaactttaactaaagattgc
ttagttagaaaaaatccttgctataggtgtccaattgcctgtggaagatgggtaaaactt
gatgatggaactgaatgtggaggaccagaatatgaaacattatggtcatttggatctgat
tgtgatgtatacgatataaatgctgtaaatacagcaaatatgttgtgtaatgaatatgga
ttagataccattacagcaggatgtactattgcagcagctatggaactttatcaaagaggt
tatattaaggatgaagaaatagcagcagatggattgtcacttaattggggagatgctaag
tccatggttgaatgggtaaagaaaatgggacttagagaaggatttggagacaagatggca
gatggttcatacagactttgtgactcatacggtgtacctgagtattcaatgactgtaaaa
aaacaggaacttccagcatatgacccaagaggaatacagggacatggtattacttatgct
gttaacaataggggaggatgtcacattaagggatatatggtaagtcctgaaatacttggc
tatccagaaaaacttgatagacttgcagtggaaggaaaagcaggatatgctagagtattc
catgatttaacagctgttatagattcacttggattatgtatttttacaacatttggtctt
ggtgcacaggattatgttgatatgtataatgcagtagttggtggagaattacatgatgta
aattctttaatgttagctggagatagaatatggactttagaaaaaatatttaacttaaag
gcaggcatagatagttcacaggatactcttccaaagagattgcttgaagaacaaattcca
gaaggaccatcaaaaggagaagttcataagttagatgtactactacctgaatattattca
gtacgtggatgggataaaaatggtattcctacagaggaaacgttaaagaaattaggatta
gatgaatacgtaggtaagctttag

  All links  
No link information was found.   
DBGET integrated database retrieval system