KEGG   Clostridium ljungdahlii: CLJU_c20810Help
Entry
CLJU_c20810       CDS       T01276                                 

Definition
transcriptional regulator/sugar kinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
clj  Clostridium ljungdahlii
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLJU_c20810
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLJU_c20810
   00052 Galactose metabolism
    CLJU_c20810
   00500 Starch and sucrose metabolism
    CLJU_c20810
   00520 Amino sugar and nucleotide sugar metabolism
    CLJU_c20810
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CLJU_c20810
   00524 Butirosin and neomycin biosynthesis
    CLJU_c20810
Enzymes [BR:clj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CLJU_c20810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2269762..2270721
Genome map
AA seq 319 aa AA seqDB search
MKGKYVVGVDLGGTKVCAAVVNFMGQVICKATLPTEAEKGENFILNRMIEITQKVIEECK
VDRKKIVGVGIGSPGPLDIDKGEIICTPNLPFRNFNIVKPIKDNFKIPVYLDNDANAAAL
GEYMFGAGKGSKSMVFITVSTGIGGGAVLNGRIYRGNTKNALEVGHMTLEKEGPLCNCGN
YGCAEVLASGTAIAREAKRAVKTGESTSLSKYKNITSKEVFKEAELGDGVSKKILDRALN
YLGICVANVVTCFDPEVVVIGGGVSKGGSIVLNKVKQVVKKRCFQSISENTNILSALLGE
DSGAIGAAALAIMEGCYEN
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaggtaaatatgtagttggagttgatttaggtggtaccaaagtttgtgctgctgtt
gtaaacttcatgggacaagtgatatgtaaggctactttaccaacggaagcggaaaaaggg
gaaaatttcatattaaataggatgatagagattactcagaaggtaattgaggagtgtaaa
gttgatagaaaaaaaatagtaggcgtgggaatcggatctccaggtccgcttgatatagac
aaaggtgagataatatgtacacccaatttgccttttagaaattttaatattgtaaagcca
ataaaggataattttaagattcccgtatatttggataatgatgcaaatgcagcggcacta
ggggaatatatgtttggtgcaggcaagggcagtaaaagcatggtatttataacagtttct
acaggaatagggggaggagctgtattaaatggtagaatatataggggtaatactaaaaat
gcactggaagtagggcatatgactttagaaaaagaaggtcctctatgtaattgtggaaat
tatggatgtgcagaggtacttgcatctggtactgctatagcacgagaagcaaaaagagca
gtaaaaacaggagagagtacttccctttccaaatataagaatataacttcaaaagaagtg
tttaaagaggcagaacttggggatggagtatctaaaaagatattagacagagctttaaat
tatcttggaatatgtgtggcaaatgtagtaacttgctttgatccggaagtagttgtaata
ggaggaggagtctccaagggtggaagtatagttttaaataaagtaaaacaggttgtaaaa
aaaagatgttttcaatctataagcgaaaacactaatatactttctgcacttttaggagaa
gattccggagctattggagctgcagctcttgctattatggaaggttgctatgaaaattag

DBGET integrated database retrieval system