KEGG   Clostridium ljungdahlii: CLJU_c23150Help
Entry
CLJU_c23150       CDS       T01276                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
clj  Clostridium ljungdahlii
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CLJU_c23150
Enzymes [BR:clj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CLJU_c23150
    3.5.1.-  
     CLJU_c23150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2538779..2539345
Genome map
AA seq 188 aa AA seqDB search
MSKKSLLVIDCQNDFITGSLACKNSENAILHIIDFISKNPDLNVFYSCDSHEMTNKSFQK
NGGMWPIHCVEGTEGALLSEKFTLGIKDRSKSPQNPEIIFRKGMNDDVEEYSAYNALNIK
NKRLHEVLDKNIIICGIASEYCVKETILDLVKNGFNVTILANGLGYVDETEHINTLNEFK
EKGMSIIF
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaatctttattagtcatcgattgtcaaaatgattttataactggcagcctt
gcatgtaaaaattcagaaaatgctatactgcatattatagattttataagtaaaaatcct
gatcttaatgtattctattcctgtgactctcacgaaatgacaaataagtcatttcaaaaa
aatggtggaatgtggcccattcactgcgtagaaggcactgaaggagctttactttctgaa
aaattcactcttggaataaaggatagaagtaaatctccacaaaatcctgaaattatcttt
agaaaaggtatgaacgatgatgttgaagagtattcggcctacaatgcactaaatattaaa
aataaaagactccacgaggtacttgacaaaaacattataatatgtggaattgccagcgag
tactgtgttaaagaaacgatacttgatctcgtgaaaaatggattcaacgtgactattctt
gcaaatggcctcggatacgtggatgaaactgaacatataaatactctaaatgagtttaaa
gaaaaaggcatgagcattattttctaa

DBGET integrated database retrieval system