KEGG   Clostridium ljungdahlii: CLJU_c23630Help
Entry
CLJU_c23630       CDS       T01276                                 

Definition
(GenBank) predicted acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
clj  Clostridium ljungdahlii
Pathway
clj00071  Fatty acid degradation
clj00280  Valine, leucine and isoleucine degradation
clj00362  Benzoate degradation
clj00620  Pyruvate metabolism
clj00630  Glyoxylate and dicarboxylate metabolism
clj00640  Propanoate metabolism
clj00650  Butanoate metabolism
clj00900  Terpenoid backbone biosynthesis
clj01100  Metabolic pathways
clj01110  Biosynthesis of secondary metabolites
clj01120  Microbial metabolism in diverse environments
clj01130  Biosynthesis of antibiotics
clj01200  Carbon metabolism
clj01212  Fatty acid metabolism
clj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLJU_c23630
   00630 Glyoxylate and dicarboxylate metabolism
    CLJU_c23630
   00640 Propanoate metabolism
    CLJU_c23630
   00650 Butanoate metabolism
    CLJU_c23630
  Lipid metabolism
   00071 Fatty acid degradation
    CLJU_c23630
   00072 Synthesis and degradation of ketone bodies
    CLJU_c23630
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLJU_c23630
   00310 Lysine degradation
    CLJU_c23630
   00380 Tryptophan metabolism
    CLJU_c23630
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CLJU_c23630
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CLJU_c23630
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    CLJU_c23630
Enzymes [BR:clj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CLJU_c23630
Exosome [BR:clj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLJU_c23630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt Ketoacyl-synt_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADK15421
UniProt: D8GL62
Position
complement(2600305..2601504)
Genome map
AA seq 399 aa AA seqDB search
MREVGIVGVGHTNFGKFSGGTFIDMISMAAVEALDDAGIKLAEGQHGIDQVFVATMGAGI
LNKQSGIASALVDTLNLRPAMAETVENGPASGASAIKLGYMAIASGMCDAVLVVGGEMMR
VVSGWEGTDFVATMLHPEAEYNYGITLPTLAGMFTRLCMEKYGITEKDLAIVSVKNHENA
LHNPVAHLHIVPNLYAITEDEDAGIVNPYVASPLRLYSVCPVSDGAAAVLLCAMDKADRF
AKKPVKIAGIGQATDTHAVAEREVSTDLLAVRLAAQNAYEMAGLKPEDIDVAELHDAFQI
LEIVESEEVGFFKRGEGHIAARNGETKIGGKIPINTSGGLKAKGHPLGATGVSQVVEIVK
QLRGEATGRQVKDAKAGLAVNFGGFGNNVVATILTKEAE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaagtaggaattgttggtgttggtcatactaattttggtaaattttcagggggg
acttttatcgatatgatcagtatggcagctgtagaagcacttgatgacgccggcattaaa
ttagctgagggacaacatggaatagatcaagtttttgtagctacaatgggcgctggtata
ttaaataaacaaagtggtattgcatctgcacttgtagacactttgaatttaagaccagca
atggctgaaactgtagaaaatggtcctgcatccggtgcttcagcaataaaactaggttat
atggcaattgccagtggaatgtgtgatgctgttctcgtcgttggtggtgaaatgatgagg
gttgtcagtggatgggaaggcacagactttgttgccaccatgcttcatcctgaggcagaa
tacaattatggtataacgcttccaacgcttgcaggaatgtttacaagattatgtatggaa
aaatacggaattacagaaaaggatttagcaattgtatcagtcaaaaatcatgaaaatgca
ctgcataatccggtagctcatcttcatatagtaccaaatctttatgcaattactgaagat
gaagacgctggcatagttaatccttatgtggcttctccacttagattatactcagtttgt
ccagtttcagatggtgcagcagcagttttgctgtgtgctatggataaagctgatagattt
gcaaagaaaccagttaaaattgctggaattggtcaagctacagatacacatgcagtagca
gaaagagaagtatctacagatttacttgcagtaagattggcagcgcaaaatgcatacgaa
atggcaggattaaaacctgaggatattgacgtagcagaactccatgatgcatttcagata
cttgaaattgtggaatctgaagaagttggtttctttaagaggggtgaaggccacatagca
gctagaaatggtgaaacaaaaattggaggtaagattccaataaacacatcaggaggctta
aaagcaaaaggtcatccacttggtgcaacgggagtttcacaagtcgtagaaatcgtaaaa
caactgagaggggaagcaactggtcgtcaggtaaaagacgctaaggctgggctcgctgta
aatttcggtggatttggcaataatgttgtagcaacaatactcacaaaggaggcggagtaa

DBGET integrated database retrieval system