KEGG   Clostridium ljungdahlii: CLJU_c24490Help
Entry
CLJU_c24490       CDS       T01276                                 

Gene name
dfrD
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
clj  Clostridium ljungdahlii
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:clj00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:clj00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2714018..2714497
Genome map
AA seq 159 aa AA seqDB search
MLHIIAALNEDYALGRDNKLLWHIPEDLKRFKDITYGKSIIMGRKTFESLPCILPKRKHI
VITRDKSYNILDERVEIVHHVEDVLKYKDSPIESFVSGGGEIYKQLLPYCNKLYLTKIHS
HEKGDTYFPKFDKSNYHVIEFKEHCYGNIKYSFITYEKN
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgttacatataattgcagctttaaatgaagattatgcacttggcagggacaataaacta
ctctggcatataccagaggatctaaaaagatttaaagacatcacctacggtaaatccatt
ataatgggaagaaaaactttcgaatccctcccatgtatacttcctaaaagaaaacatatt
gtcattacaagagataaaagctataatattttagatgaaagagtagaaatagtccaccat
gttgaagacgttttaaaatacaaagattctcctatagaaagctttgtttcaggtggagga
gaaatttataagcaattactcccctactgtaataaattataccttacaaaaattcactct
catgaaaaaggcgatacctattttcctaaatttgacaaaagtaattaccatgtaatcgaa
ttcaaagagcactgttatggcaatataaaatatagttttataacttatgaaaaaaattaa

DBGET integrated database retrieval system