KEGG   Clostridium ljungdahlii: CLJU_c26720Help
Entry
CLJU_c26720       CDS       T01276                                 

Gene name
asnB
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
clj  Clostridium ljungdahlii
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:clj00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2955616..2957457)
Genome map
AA seq 613 aa AA seqDB search
MCGIAGWINLKEDISKNRDVILNMTDTLKKRGPDDAGYYFSKNALLGHRRLVVVDPSGGA
QPMSKSVGGRRYIIVYNGELYNTEDLRKLLVKENYSFKSYSDTEVLLTSYIHWGINCLKH
INGIYAFAIWDESKNQIFMARDPLGVKPLFYTVKDNSLIFGSEIKTLLAHPFIEPVVDRD
GLTEIFALGPARSLGGGVFKGIYEVPPANYVLYDRYGIKLREYWKPQCKIHNEDTETTAQ
HVKTLLVDAIKRQLVADVPVCTLLSGGLDSSVISTVAAAEFKKQGKTLNTYSIDYEDNDK
YFKANSFEPTPDRVWALKMSDYIKSVHHGIINTSSDLADALYDSVRASDLPGMADIDSSL
YLFCKEIRKDNTVALSGECADEIFGGYPWYRRPEDINADTFPWSKSINSRKEILSDELKA
LDLEEYLNEQYKSSIKQVPHIDGESKLEYRMRELFYLNIKWFMITLLNRKDRMSMSNSLE
VRVPFADYRLVEYAFNIPPEIKFYKGREKGLLRKALEGILPKEIVERKKSPYPKTHNPEY
TKIVTKRMSDIMKDKSSPILPLIDKKSVKTLIDTGGSSFKAPWFGQLMRGPQLLAYLIQV
NTWLKEYNIKIEF
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgcaggatggattaatttaaaagaggacatttccaaaaacagagatgtt
attttaaatatgacagatactttaaagaaaagaggacctgatgatgcaggctattacttt
tctaaaaatgcactcttaggacacagaagacttgtagttgtggatccttctggtggtgca
cagcctatgtcaaaaagtgtaggtggcaggagatatattattgtatacaatggagaactt
tataatactgaggatttaagaaagttacttgtaaaagaaaattattctttcaaatcctat
tctgatacagaggtacttctaaccagttacatccattggggaataaattgtttgaaacat
ataaatggaatatatgcttttgcaatatgggatgaaagtaaaaatcagatatttatggca
agagatccattaggagtaaaaccactattttatacagtaaaagataattcacttatattt
ggttcagaaataaaaacattactggcccatccctttattgaacctgtagttgatagggat
ggcctgactgaaatatttgcccttggacctgctagatctttgggtggaggtgtatttaaa
ggtatatatgaagtaccacctgctaattatgttctatatgatagatatggtattaagctg
cgagaatactggaaaccacagtgtaaaattcacaatgaagatacagaaacaacggctcag
catgtaaaaacactgcttgtagatgccattaagagacagcttgtagcagatgtacccgtt
tgtacactgctttcaggaggacttgattctagtgttatatctacagtagctgcagcagag
tttaaaaaacaaggaaagactttaaatacctactctattgattatgaagataatgacaaa
tattttaaagcaaattcttttgaacctacaccagatagagtctgggcattaaaaatgtcg
gattatataaaaagtgttcatcatgggattataaatacaagctctgatttagcagatgcc
ctttatgattctgtaagagctagcgatttgcctggaatggcagacattgattcctcacta
tatcttttttgcaaggaaataaggaaagacaatacagttgcactgtcaggtgaatgtgca
gatgaaatttttggaggatatccgtggtatagaagacctgaagacattaatgcagatact
tttccatggtcaaaatctattaattcaagaaaggaaatattgtctgatgaattaaaggca
cttgatttggaggaatatttaaatgaacaatataaaagtagtataaaacaggtgcctcac
atagatggtgaatccaaattagagtacagaatgagagaattattttatttaaatataaaa
tggtttatgataacacttttaaatagaaaagatcgtatgagtatgtctaatagtttggag
gttagagtaccttttgcagattatagattggtagagtatgcttttaatataccaccagag
ataaaattttataaaggaagagaaaagggcttactgagaaaggcactagaaggaatactg
ccaaaggaaattgttgaaaggaaaaagagcccttacccaaaaactcataaccctgaatat
acaaaaatagttacaaaacggatgtcagatattatgaaagacaagagttctcctattttg
ccgcttatagataaaaaatcagttaagacattaatagatacaggaggatcttcttttaaa
gcaccttggtttggccaacttatgagaggaccacagcttcttgcatatcttattcaggta
aatacatggcttaaagagtataatatcaagatagaattttaa

DBGET integrated database retrieval system