KEGG   Clostridium ljungdahlii: CLJU_c29050Help
Entry
CLJU_c29050       CDS       T01276                                 

Definition
fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
clj  Clostridium ljungdahlii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:clj01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:clj00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:clj00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:clj00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:clj00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3205054..3207054)
Genome map
AA seq 666 aa AA seqDB search
MIFYDENNLDIIEKDLRYLQLLSREYPTISSASTEIINLQAILNLPKATEHFISDIHGEY
ESFTHMLRNASGVIKRKIDDVFGNSLREEQKASLATLVYYPERKIELIKEKEHNLEEWYR
ISLYQLIELCKNVSSKYTRSKVRKALPSDFSYIIEELLHDQDDKVDKQAYYNGIIKTIID
INRAPEFIIAISNVIQRLVVDRLHIIGDIYDRGPGAEIIMDALMKHHSVDIQWGNHDMLW
MGAAAGCEACIANVLRISLRYANLHTIEDGYGINLLPLATFALEFYKDDPCKNFIPKTLN
KDISKNELNLLAKMHKAIAIMQFKLEAEIIKRHPEFKMDDRLLLDKIDIEKWEIDIYGHN
YKLNDSKFPTIDWNDPYKLTDREQELIEKLTSSFVNSEKLQRHIKFLYGKGSIYLVYNSN
LLYHGCIPLNKDGSFREVKIGKISYSGRELLDRYDRLARDAFFFKNNTNSKKYGMDMMWY
MWCGEDSPVFGKVRMTTFERYFIDDKIAHYEKKNYYYQYRDDENVCKNILAEFNLPPESS
HIINGHIPVKTKEGESPIKANGRLLVIDGGFCKAYQPETGIAGYTLIYNSYGLLLTSHEP
FGAIKNAIEEDKDILSSTVILEHVTKRKRVEDTDIGKDLTKQIADLEKLLIAYRKGLIKE
DNNQIE
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgattttctatgatgagaataatttagatataatagaaaaagatttaagatatcttcaa
ttattatctagagaatatcccacaatatctagtgccagtacggaaattataaatcttcag
gctatattgaatttaccaaaagctacagaacactttataagtgacattcatggagaatat
gaatcctttacccatatgcttagaaatgcatctggtgtaataaagaggaaaattgatgat
gtgtttggaaattcattgagagaagaacagaaggcatcactggcaacccttgtatattac
cctgagagaaaaatagaattaattaaggaaaaagaacacaatttggaagaatggtataga
ataagtttatatcaattaattgaattgtgtaagaatgtatcttcaaaatatactcgctct
aaagtgagaaaagcacttccatcagatttttcatatataatagaagaactgcttcacgac
caggatgataaggtagataaacaagcgtattataacggtataataaaaactataatagat
ataaatcgtgcacctgaattcatcatagctatttcaaatgtaatacagaggttagttgta
gacagacttcatataattggggatatatatgacaggggaccaggagctgaaattataatg
gatgctcttatgaaacatcattctgtggatattcaatggggaaatcatgatatgctctgg
atgggagcggcagctggctgcgaagcttgtatagctaatgtgctcagaatatcacttaga
tatgctaatttgcatactattgaagatggatatggaataaacttacttccgcttgctact
tttgcccttgaattctataaagatgatccttgtaagaattttattcctaagactttaaac
aaggatataagtaaaaatgaacttaatttactggcaaaaatgcacaaggctatagctata
atgcaatttaaattagaggcagaaataataaaaaggcatcctgaatttaagatggatgat
agacttctacttgataaaatagatatagaaaaatgggaaatagatatatatggtcataat
tataagttaaatgatagcaagtttcctactatagattggaatgacccatataaacttaca
gatagggaacaagagttaattgaaaagttgactagttcttttgtaaacagtgagaaactt
caaagacatattaaattcttatatggtaaagggagtatatacttggtatataattcaaat
cttttataccacgggtgtattccattgaataaagatggtagttttagagaagtgaaaata
ggaaaaataagctacagcggcagagaacttttagataggtatgaccgtttagcgagagat
gcttttttctttaaaaataatactaatagtaaaaaatatggtatggatatgatgtggtat
atgtggtgtggagaggattcacctgtgtttggaaaagttagaatgacaacttttgaaaga
tattttattgatgataagatagcacactatgaaaagaagaattattattaccaatatagg
gatgatgagaatgtgtgcaagaatatactggcagaatttaatttgccacctgaaagttct
cacattataaatggtcatattccagtaaaaactaaggaaggggaaagtcctataaaggca
aacggaagattacttgtaatagatggaggattttgcaaagcatatcagcctgaaaccgga
atagcagggtatactctaatatataattcttatggattgctgctcacttctcacgaaccg
tttggtgctataaaaaatgctatagaagaggacaaagatattttatcttctacggtgatt
ttggaacatgtaactaaaagaaaaagggtagaagatacagacataggaaaagatctgaca
aaacagatagctgatttggaaaagcttttaatagcatataggaagggattaattaaagaa
gataacaatcaaattgagtga

DBGET integrated database retrieval system