KEGG   Clostridium ljungdahlii: CLJU_c33180Help
Entry
CLJU_c33180       CDS       T01276                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
clj  Clostridium ljungdahlii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLJU_c33180 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLJU_c33180 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLJU_c33180 (thrC)
Enzymes [BR:clj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CLJU_c33180 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3628283..3629773)
Genome map
AA seq 496 aa AA seqDB search
MKEIHYNSTRGLNGNYTASQAILKGISEDGGLFVPDSIPSVNEEELQKFKNMTYKELALC
IIGKFFTDFTEDELKKCIDLAYDNKFESDEIVPLKKVGDVFYLELFHGPTLAFKDMALCL
LPHLMQTAAKKQNLHKKIVILTATSGDTGKAALEGFADVEDTRIVVFFPEKGVSDIQKRQ
MVTQVGKNTKVIGIKGNFDDAQTEVKKIFNDEELKKELDEKSYMFSSANSINIGRLIPQV
VYYFHGYMELLRKGQIKLGEKINFVVPTGNFGNILAAYYAKKMGLPINKLLCASNDNKVL
YDFLKSGIYDAEREFIVTISPSMDILISSNLERFIYDISGKDSSVVQGLMKDLNKNRKYS
VSENMKEELKPFYGGFATEGETLHSISDVFKDYKYLMDTHTSVAYSVYRKYFQDTGDDTK
TIIVSTASPFKFTKSVMSALDDKYKNQKDFDLIEVMSKTASLEIPKPIEKLMKSEVIHST
VCEKQQMKDEIRKFLV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagaaattcattataacagtactagaggattaaatggaaactatactgcatctcaa
gctatactaaaaggaatatcagaagatggtggattgtttgttccagacagcataccttct
gtgaatgaagaagaattacaaaaattcaaaaatatgacttataaggaattagctttatgc
ataatcggaaagtttttcaccgattttactgaagatgagttgaagaagtgcatagaccta
gcttatgacaataaatttgaatcagatgaaatagtgccactaaagaaggttggggatgtg
ttttatttagagttgtttcatggaccaactttagcttttaaagacatggcattgtgtctt
ctaccacatctaatgcagactgctgcaaaaaaacaaaatttacataaaaagatagttata
cttacagcaacttctggagatacaggaaaggcagcactagaaggctttgcagatgtagag
gatacaagaatagtagtatttttccctgaaaaaggggtaagtgatatacaaaaaagacag
atggttacccaggtaggcaaaaatactaaagttataggaataaagggaaattttgatgat
gcccagactgaagttaagaaaatttttaatgatgaagaattaaaaaaagaattggatgaa
aagtcttatatgttttcttctgccaattccataaatataggaagacttatacctcaagta
gtatattattttcatggatatatggaacttttaaggaaagggcaaataaaattaggagaa
aaaataaattttgtagttcctacaggtaattttggaaatatacttgcagcttattatgca
aaaaaaatgggcctacctataaataagcttttatgtgcttcaaatgataataaagtatta
tatgactttttaaaaagtggaatttatgatgctgagagagaatttatagtaactatatct
ccttctatggatatactcatatccagtaatcttgaaagattcatatatgatataagtggg
aaggattcttcagttgtacagggattaatgaaagatttaaataaaaataggaagtatagt
gtaagtgaaaatatgaaagaagaattaaaaccattttatggtggatttgcgaccgaaggg
gaaacacttcactccataagtgatgtcttcaaagattataaatacctaatggacacacat
acttcagtggcttattccgtgtatagaaagtattttcaggatacaggagatgacacaaaa
accattattgtttctactgcaagtccttttaaatttacaaaatccgtaatgagtgcttta
gacgataagtataagaatcaaaaagattttgaccttatagaagtaatgagcaaaactgct
tctctcgaaattcctaaacctatagagaaactaatgaaaagtgaagttattcacagtact
gtatgtgaaaaacaacagatgaaagatgagattagaaaattcttagtataa

DBGET integrated database retrieval system