KEGG   Clostridium ljungdahlii: CLJU_c33920Help
Entry
CLJU_c33920       CDS       T01276                                 

Definition
hypoxanthine-guanine phosphoribosyltransferase (EC:2.4.2.8)
Orthology
K00760  
hypoxanthine phosphoribosyltransferase [EC:2.4.2.8]
Organism
clj  Clostridium ljungdahlii
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CLJU_c33920
Enzymes [BR:clj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.8  hypoxanthine phosphoribosyltransferase
     CLJU_c33920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3705933..3706454
Genome map
AA seq 173 aa AA seqDB search
MENKSKNILISQERIGKRIEEVGKIITTKYKDKNLYVLSLLRGSFIFTADLVRQIKLPVK
IGFMTTSSYGNSETSSGEIKIVNDILDDLKGYDVLIVDDITDTGITMDFAIDHVKSLGAS
SVKCCVLLDKPDRRKISLTPDFCCFEIPDVFVAGYGLNYGDYYRNVPYIFNWE
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaaatcgaaaaacatattgatatcccaagaacgaattggaaagaggatagaa
gaagtaggtaaaataataaccactaaatataaagataaaaatttatatgtattatccctt
ttaagaggaagttttatatttacagcagatttagtaagacaaataaagcttcctgtaaaa
ataggatttatgacaacttcaagttatggaaattctgaaacatcatctggtgaaataaaa
attgtaaatgatatattagacgacctgaaagggtatgatgttttaattgtagatgacata
acagatacaggtattactatggactttgctatagaccatgtaaaatctctaggtgcttcc
agtgtaaaatgctgcgttcttctagacaaacctgacagaagaaaaatttcattgacccca
gatttttgttgtttcgagattcccgatgtatttgttgcaggttatggattaaattatgga
gattattatcggaatgtaccttacatatttaactgggaataa

DBGET integrated database retrieval system