KEGG   Clostridium ljungdahlii: CLJU_c34190Help
Entry
CLJU_c34190       CDS       T01276                                 

Gene name
galU2
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
clj  Clostridium ljungdahlii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CLJU_c34190 (galU2)
   00052 Galactose metabolism
    CLJU_c34190 (galU2)
   00500 Starch and sucrose metabolism
    CLJU_c34190 (galU2)
   00520 Amino sugar and nucleotide sugar metabolism
    CLJU_c34190 (galU2)
Enzymes [BR:clj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CLJU_c34190 (galU2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3737158..3738075)
Genome map
AA seq 305 aa AA seqDB search
MNVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVASGIEEILIITGKNK
RAIEDHFDKSVELEQELENKDKKDLLKMVQDISNMADIYYIRQKEPKGLGHAISCAKTFV
GNQPFAVMLGDDVVDSKEPCLKQLIKCYDEYKTSIIGVQEVPKEYVDRYGIVKGMYIEDK
VYKVKDLIEKPKVEEAPSNIAILGRYIITPSIFEILENTTPGKGGEIQLTDALRTLAQNE
AMYAYNFEGRRYDVGDKLGFLQATVEYALKRDELKKPFMKYLLDLKEQKIFKEVYDDITS
NSHNK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtaaaaaaagctataataccagctgctggacttggaacaagatttttgcctgct
acaaaggcccaacctaaggaaatgctgcctatagtagataagcctaccatccaatatatt
atagaagaagcagtagcatctggaatagaagaaattttgataataacaggaaaaaataag
agggcaatagaagatcactttgataaatccgtagaattggaacaggaactggagaataaa
gacaagaaagatcttttgaaaatggtacaggatatatcaaatatggcagatatatattac
ataagacagaaggaacctaagggtcttggacatgcaataagttgtgcaaaaacttttgtt
ggaaatcaaccttttgcggtaatgctcggtgatgatgtggtagatagtaaagaaccttgc
ctaaaacagcttataaaatgctatgatgaatataaaacttcaattataggtgtacaggag
gttcctaaagaatacgtagatagatatggtatagtaaaaggaatgtatatagaagataag
gtatacaaagttaaagatttaatagaaaaacctaaagttgaagaggctccgtctaatata
gccatacttggaagatatataataacaccatccatatttgaaatattagagaacactact
ccaggaaagggaggagaaattcaactcacagatgccctgagaactttagctcaaaatgaa
gctatgtatgcatataattttgagggaagaaggtatgatgtgggagataaacttggattt
ttacaagccactgtggaatatgccttgaagagagatgaactgaaaaagccttttatgaaa
tatcttttggatttaaaagaacaaaagatatttaaagaagtttatgatgatataacttct
aattctcataacaaatag

DBGET integrated database retrieval system