KEGG   Clostridium ljungdahlii: CLJU_c37840Help
Entry
CLJU_c37840       CDS       T01276                                 

Definition
dTDP-4-dehydrorhamnose 3,5 epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
clj  Clostridium ljungdahlii
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    CLJU_c37840
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CLJU_c37840
Enzymes [BR:clj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     CLJU_c37840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4105085..4105600
Genome map
AA seq 171 aa AA seqDB search
MEKTRTKVMKEEGMWVDNIIEGVKYKRLKVYPDERGSLIEIFRNDDEDFLGGKFGQLITS
ICYPGVVKGWHIHSVQVDRLAVISGMAKIVLYDARENSPTKGEINEFFVGERNPLFILIP
PGVYHGLKAIGTQPSITLGLPTELYKYDEPDEFRVHPHNDEIPYNWDRQDG
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaacaagaacaaaagtaatgaaagaagagggaatgtgggtagataatattatt
gaaggtgtaaagtacaaaagattgaaggtatatccagatgaaagaggctctttaatagaa
atctttagaaatgatgatgaagattttttaggtggaaaatttggacaacttattacatca
atttgttatcctggtgtagtaaaaggttggcatatacattctgttcaggttgatagatta
gcagtaatttctggcatggcaaaaatagtgctttatgatgctagagaaaattctccaaca
aaaggtgaaataaatgaattttttgttggagaaagaaatcctttatttatacttatacca
ccaggagtttaccatggattaaaagcaattggaacacaaccatcaattacactaggtctt
ccaacagaactttataaatatgatgaacctgatgaatttcgtgtacatcctcataatgat
gaaatcccatacaattgggatagacaagatggttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system