KEGG   Clostridium ljungdahlii: CLJU_c39130Help
Entry
CLJU_c39130       CDS       T01276                                 

Gene name
tim
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
clj  Clostridium ljungdahlii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLJU_c39130 (tim)
   01230 Biosynthesis of amino acids
    CLJU_c39130 (tim)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLJU_c39130 (tim)
   00051 Fructose and mannose metabolism
    CLJU_c39130 (tim)
   00562 Inositol phosphate metabolism
    CLJU_c39130 (tim)
Enzymes [BR:clj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CLJU_c39130 (tim)
Exosome [BR:clj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CLJU_c39130 (tim)
  Exosomal proteins of bladder cancer cells
   CLJU_c39130 (tim)
  Exosomal proteins of melanoma cells
   CLJU_c39130 (tim)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4258860..4259606)
Genome map
AA seq 248 aa AA seqDB search
MRKAIIAGNWKMNKTVTEALKLVEELKPLVSDAKCDVVVCPPYVCLDAVVKAVKGSNIKV
GAQNMHYEESGAYTGEVAPNMLKDIGIDFVIIGHSERRQYFNETDESINKKVKKAFEYDI
NPIVCCGETLEERESDVTEEVLGKQIKIDLAGLEKSQVGKLVVAYEPIWAIGTGKTATDK
QANETIAYIRSVIAKMYGRETAEKTRIQYGGSVKPATIKAQMAQSDIDGALVGGASLKSE
DFAKIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaggcaataatagctggaaattggaaaatgaataagactgtaactgaagcactg
aagttagttgaagagttaaaaccgctagtaagtgatgcgaaatgtgatgtagttgtatgc
cctccttatgtttgtttagatgcagttgtgaaagcagtaaagggaagtaacataaaagta
ggagcacaaaatatgcattatgaagaaagtggtgcgtacactggagaagtagctcctaat
atgcttaaggatattggaatagattttgtaataattgggcacagtgagagaagacaatat
tttaatgagacagacgagtcaattaataaaaaagtgaaaaaagcttttgaatatgatata
aatcctatagtttgttgtggagagactttagaagaaagagaatcagatgtaacagaagaa
gttttagggaaacagataaagattgatcttgcgggacttgaaaaaagtcaggtgggaaag
ttagttgtagcatacgaaccaatatgggctataggtacgggaaaaactgctacagataaa
caggcgaatgaaactatagcttatattagaagtgtaattgccaaaatgtacggtagggaa
acagcggagaaaacaagaattcaatatggtggttctgtgaaaccggctacaattaaagct
cagatggcacagtcagatatagatggagcgttagttggaggagctagtttaaagtcagaa
gactttgcaaaaatagttaattactaa

DBGET integrated database retrieval system