KEGG   Clostridium ljungdahlii: CLJU_c39130Help
Entry
CLJU_c39130       CDS       T01276                                 

Gene name
tim
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
clj  Clostridium ljungdahlii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLJU_c39130 (tim)
   01230 Biosynthesis of amino acids
    CLJU_c39130 (tim)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLJU_c39130 (tim)
   00051 Fructose and mannose metabolism
    CLJU_c39130 (tim)
   00562 Inositol phosphate metabolism
    CLJU_c39130 (tim)
Enzymes [BR:clj01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CLJU_c39130 (tim)
Exosome [BR:clj04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CLJU_c39130 (tim)
  Exosomal proteins of bladder cancer cells
   CLJU_c39130 (tim)
  Exosomal proteins of melanoma cells
   CLJU_c39130 (tim)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4258860..4259606)
Genome map
AA seq 248 aa AA seqDB search
MRKAIIAGNWKMNKTVTEALKLVEELKPLVSDAKCDVVVCPPYVCLDAVVKAVKGSNIKV
GAQNMHYEESGAYTGEVAPNMLKDIGIDFVIIGHSERRQYFNETDESINKKVKKAFEYDI
NPIVCCGETLEERESDVTEEVLGKQIKIDLAGLEKSQVGKLVVAYEPIWAIGTGKTATDK
QANETIAYIRSVIAKMYGRETAEKTRIQYGGSVKPATIKAQMAQSDIDGALVGGASLKSE
DFAKIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaggcaataatagctggaaattggaaaatgaataagactgtaactgaagcactg
aagttagttgaagagttaaaaccgctagtaagtgatgcgaaatgtgatgtagttgtatgc
cctccttatgtttgtttagatgcagttgtgaaagcagtaaagggaagtaacataaaagta
ggagcacaaaatatgcattatgaagaaagtggtgcgtacactggagaagtagctcctaat
atgcttaaggatattggaatagattttgtaataattgggcacagtgagagaagacaatat
tttaatgagacagacgagtcaattaataaaaaagtgaaaaaagcttttgaatatgatata
aatcctatagtttgttgtggagagactttagaagaaagagaatcagatgtaacagaagaa
gttttagggaaacagataaagattgatcttgcgggacttgaaaaaagtcaggtgggaaag
ttagttgtagcatacgaaccaatatgggctataggtacgggaaaaactgctacagataaa
caggcgaatgaaactatagcttatattagaagtgtaattgccaaaatgtacggtagggaa
acagcggagaaaacaagaattcaatatggtggttctgtgaaaccggctacaattaaagct
cagatggcacagtcagatatagatggagcgttagttggaggagctagtttaaagtcagaa
gactttgcaaaaatagttaattactaa

DBGET integrated database retrieval system