KEGG   Clostridium ljungdahlii: CLJU_c40360Help
Entry
CLJU_c40360       CDS       T01276                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
clj  Clostridium ljungdahlii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:clj00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLJU_c40360
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLJU_c40360
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLJU_c40360
Enzymes [BR:clj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CLJU_c40360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4387303..4388562)
Genome map
AA seq 419 aa AA seqDB search
MYTGKSKCLNCGHIFEDESIFEGCPFCKTDSFVSNITPIYDLPKTNGTKQEFNNIFSGKG
IEKYIPVLPFKAGTNLVSLNEGNTPLTYLNSISNELNIKLYAKDETRNPTWGHKDRLNVI
LINKALEKKAPGVIYASTGNNGASGSAYAAKAGLPCIILTVKGVNKTLDTFMQAYGACVV
GVKTTSDRWNILKECVDKFGWYPATNYTVPIVGSNPWAIEGYKIIAYELFLDMEELPDKI
VVPICYGDALFGINKGFEELMNMGFIQKMPQMVAVEDYGPIHNAIKENSKIIKPIKGWGS
IASSMSTVYGTYHSLYTVRNYNGLTAVMDNNEQISSAQLELAQKEGLYCESASATTLVGV
KKLLASGQIKSGDKVVMLITASGVKDTANTSKYVGEVPECEANMEEFSKLLQKKYDITL
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtatacaggaaaatcaaagtgcttaaattgcgggcacatttttgaagatgaatcaata
tttgagggatgcccattctgtaaaactgactcttttgtttctaatataacacctatttat
gatctccctaaaactaatggaacaaagcaggaatttaataatattttttctggtaaagga
atcgaaaaatatattcctgttctaccatttaaggccggtacaaatttagtttctttaaat
gaagggaatacacctcttacatatttaaattcaatcagcaacgaattgaatataaagtta
tatgcgaaagatgaaacgagaaatccaacttggggacacaaggatagactaaatgtaatt
cttattaataaagcactagaaaagaaggctccgggggtaatttatgcatctactggcaat
aacggagcatctggctcagcttatgcagcaaaagcaggcttgccatgcattattttaact
gtaaaaggtgttaataagacgttggatacttttatgcaggcatatggagcttgtgtggtt
ggagtaaaaactacttcagatcgatggaacatcttaaaagaatgtgttgataagtttgga
tggtatcctgcaactaattatacagttccaatcgtaggtagtaatccttgggctattgaa
ggttacaaaattattgcttatgaactctttcttgatatggaagaactaccagataaaatt
gtagtacctatttgttatggagatgcattatttggtataaataaaggttttgaagaatta
atgaacatgggatttattcaaaaaatgccacagatggttgctgtagaagattatggacca
atccataatgcgattaaagaaaactctaaaatcattaaacctattaaaggatggggaagt
attgcatcatctatgtcaactgtttatggaacttatcattctctttataccgtgcgcaat
tacaatggattaacagctgttatggataacaatgaacaaatttcttcagctcagttagag
cttgcccaaaaggaaggactttactgtgaatctgcatctgcgacaactttggttggtgta
aagaagttacttgcatctggacaaataaagagtggggataaagttgtgatgctgataaca
gcaagcggagtaaaagatacggcaaatacttctaaatatgtgggtgaagtacctgagtgt
gaagcaaacatggaagagttcagcaaacttttgcagaaaaagtatgatataactctttaa

DBGET integrated database retrieval system