KEGG   Clostridiales genomosp. BVAB3: HMPREF0868_0055Help
Entry
HMPREF0868_0055   CDS       T01181                                 

Definition
hydrolase, alpha/beta domain-containing protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
clo  Clostridiales genomosp. BVAB3
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:clo00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(35876..36925)
Genome map
AA seq 349 aa AA seqDB search
MTQHNLQPAFTSPLLPTWPNENFAAVMENRIRPYLARERMSDFVASGARRIYYESYHGSL
PSSHAIIIVHGFCGFTRKYEEMIYLYRRAGYDVYIADNYGHGFSTRGVNDPSLVDVADYR
TYVDDLHALIAAAVLPLNYKEIILFGHSMGGAIVSLFLLRYPYLCRTAILSSPMLGINSG
FCPAWLLELICRLKVACGAKPDYIKGQHPFPEQPDFDGSSCSSKPHYDHIFAWRQTEPKY
RTHGASWQWMGASLKAIRQIQRHAADISARILLLQAGEDKLVPAAAQIKFASKAPNVKLK
LIAHSRHEIYNACLPERCEYYQAIAKFLAQTSGEDRTSTGEAETRESGN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacataatctacaaccagcttttacttcaccgctgctaccaacttggccgaat
gaaaatttcgccgccgttatggagaaccgcattcgcccctatttagcgcgagaaagaatg
tcggactttgtcgcttccggagctcgccgaatttattacgaatcttatcacggatcttta
ccatcgtctcacgccatcatcatcgtccacggtttctgcggtttcacacgtaaatatgaa
gaaatgatctatctataccgacgagccggctacgatgtttacattgccgataactacggc
cacggcttttctacgcgcggagtgaatgatccgtctttagttgacgttgccgactaccgc
acctatgttgacgatttgcacgccctaatagcggctgccgttttgccgctcaactacaaa
gaaatcattcttttcggccattccatgggcggagcgatagtcagcctgtttttgttgcgc
tatccctacctatgccgaacggccattttgtcttctccgatgctgggcatcaattccggc
ttttgtcccgcttggctgttggaactcatttgccgcctaaaagtcgcctgtggagcaaaa
cctgactatatcaaaggccagcatccattccccgagcaacccgactttgacggcagcagc
tgttcatcaaaaccacactatgatcacatttttgcttggcgacagactgagccgaaatac
cgcacccacggtgccagttggcaatggatgggcgcgtcccttaaagcaatacgccaaata
caacggcatgccgccgacatttccgcccgcattttgcttttgcaggccggtgaagataag
ctggtcccggcggcggcgcaaatcaaatttgcctccaaagcgccaaatgtaaagcttaaa
ctgattgcccatagccgccacgaaatttacaacgcctgtttaccggaacgctgtgaatac
tatcaggcaatagccaaatttttggctcaaacttccggagaagatcgtacatcaaccggt
gaagctgaaacacgagaatccggcaactaa

DBGET integrated database retrieval system