KEGG   Clostridiales genomosp. BVAB3: HMPREF0868_0055Help
Entry
HMPREF0868_0055   CDS       T01181                                 

Definition
hydrolase, alpha/beta domain-containing protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
clo  Clostridiales genomosp. BVAB3
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:clo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HMPREF0868_0055
Enzymes [BR:clo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     HMPREF0868_0055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(35876..36925)
Genome map
AA seq 349 aa AA seqDB search
MTQHNLQPAFTSPLLPTWPNENFAAVMENRIRPYLARERMSDFVASGARRIYYESYHGSL
PSSHAIIIVHGFCGFTRKYEEMIYLYRRAGYDVYIADNYGHGFSTRGVNDPSLVDVADYR
TYVDDLHALIAAAVLPLNYKEIILFGHSMGGAIVSLFLLRYPYLCRTAILSSPMLGINSG
FCPAWLLELICRLKVACGAKPDYIKGQHPFPEQPDFDGSSCSSKPHYDHIFAWRQTEPKY
RTHGASWQWMGASLKAIRQIQRHAADISARILLLQAGEDKLVPAAAQIKFASKAPNVKLK
LIAHSRHEIYNACLPERCEYYQAIAKFLAQTSGEDRTSTGEAETRESGN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacataatctacaaccagcttttacttcaccgctgctaccaacttggccgaat
gaaaatttcgccgccgttatggagaaccgcattcgcccctatttagcgcgagaaagaatg
tcggactttgtcgcttccggagctcgccgaatttattacgaatcttatcacggatcttta
ccatcgtctcacgccatcatcatcgtccacggtttctgcggtttcacacgtaaatatgaa
gaaatgatctatctataccgacgagccggctacgatgtttacattgccgataactacggc
cacggcttttctacgcgcggagtgaatgatccgtctttagttgacgttgccgactaccgc
acctatgttgacgatttgcacgccctaatagcggctgccgttttgccgctcaactacaaa
gaaatcattcttttcggccattccatgggcggagcgatagtcagcctgtttttgttgcgc
tatccctacctatgccgaacggccattttgtcttctccgatgctgggcatcaattccggc
ttttgtcccgcttggctgttggaactcatttgccgcctaaaagtcgcctgtggagcaaaa
cctgactatatcaaaggccagcatccattccccgagcaacccgactttgacggcagcagc
tgttcatcaaaaccacactatgatcacatttttgcttggcgacagactgagccgaaatac
cgcacccacggtgccagttggcaatggatgggcgcgtcccttaaagcaatacgccaaata
caacggcatgccgccgacatttccgcccgcattttgcttttgcaggccggtgaagataag
ctggtcccggcggcggcgcaaatcaaatttgcctccaaagcgccaaatgtaaagcttaaa
ctgattgcccatagccgccacgaaatttacaacgcctgtttaccggaacgctgtgaatac
tatcaggcaatagccaaatttttggctcaaacttccggagaagatcgtacatcaaccggt
gaagctgaaacacgagaatccggcaactaa

DBGET integrated database retrieval system