KEGG   Clostridiales genomosp. BVAB3: HMPREF0868_0263Help
Entry
HMPREF0868_0263   CDS       T01181                                 

Definition
putative ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
clo  Clostridiales genomosp. BVAB3
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:clo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    HMPREF0868_0263
Enzymes [BR:clo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     HMPREF0868_0263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1603743..1604747)
Genome map
AA seq 334 aa AA seqDB search
MRILNIGSLNLDRTYAVRDFVAPGETISALDYQTHCGGKGLNQSLALARAGAAVSHLGTI
GFDGGILRDSLAQAGVDIRFLRQSDTANGHAVIQVDAHGQNCIIVCAGSNAEVTVEQIEA
GLASLQPGDWVLLQNETSNLAYAVERASALGLKLILNPSPINPALLNADLRPVNLFILNE
TEARLLADQQTDEPMKLMAALRTIYPQSEILLTCGAQGAFYQDVAPNDLTYFRPAYQVAA
VDTTAAGDTFTGYFLAAMSRQAGVQAALRLAAAAAALAVSRPGAQSSIPELAEVERFIAE
REIEGAEAECVTAAQDKRQASAQSDSGHMKEITN
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtattttaaacataggttcattgaatttggatcgtacatatgctgtgcgtgatttt
gttgcccccggtgagacgatcagcgctcttgattatcagactcattgcggcggcaaaggc
cttaatcagtcgttggctttggcgcgggcgggggcggcggtaagtcatttgggtacgatc
ggatttgacggcgggatactaagggactcgcttgctcaagcaggggtagatatccgtttt
ttgcgtcaaagtgacacggcgaatgggcatgcggtaattcaggttgacgcacatggccaa
aattgcattattgtttgtgccggcagcaatgcagaagtaaccgttgagcagattgaggct
gggttggcttcgttgcagccaggagattgggtgctgttgcaaaacgaaacatccaatttg
gcttatgctgtcgaacgggcaagtgccttgggtttgaaacttattcttaatccgtcgccg
atcaatccggcattgttgaacgctgatttgcgcccggttaatctgtttattttgaatgaa
acagaggcccggttgctggcggatcagcaaacggacgaaccgatgaaactgatggcagct
ttgcggacgatttaccctcagagtgaaattttgcttacttgcggggcgcagggggcattt
tatcaagacgtcgccccgaacgatctgacctacttccggccggcttaccaggttgcggcg
gtggatacgacggcggcaggcgacacgtttaccggctatttcttggcggcgatgagccga
caggccggcgtgcaggcggcgctgcgtttggcagccgcggcagcagctttggcggttagt
cggccgggggcgcaaagctctattcctgaattggcggaggtggagagatttatcgccgaa
cgggagatagagggtgcagaggcggaatgtgtaacggcagcgcaggacaagaggcaggcg
tcagcacaaagtgattccgggcacatgaaagagattacaaattga

DBGET integrated database retrieval system