KEGG   Clostridiales genomosp. BVAB3: HMPREF0868_0273Help
Entry
HMPREF0868_0273   CDS       T01181                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
clo  Clostridiales genomosp. BVAB3
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:clo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0868_0273
   00052 Galactose metabolism
    HMPREF0868_0273
Enzymes [BR:clo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     HMPREF0868_0273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1593119..1594090)
Genome map
AA seq 323 aa AA seqDB search
MQEYTIQNDYIALSVLDYGLRIKEIFLKPIQQNAVLAYAENSEYLQEVNFLGATIGPNAN
RIKDGKFSIAGTEWNWEKNDGANNLHSGKYGLHLKYWHCSVIENRIHAKYFQEIPFMCEY
EAVFSLNNSQIEVEYFAVPDAPALINMTNHSYFHLDAAATVLDYQLKLAADFYTPRTADG
IPTGEIRSVAGTALDFREYKTISTMLAAARQTGLTKEGFDHNLLVASKGFRLLASVLTSR
VKLDIFSDAPGFQFYTAENLISHGRRTPYKGLCIEPQYIPNSINCSYLKQPVFTGAQPFH
QKTVYAFEFPDTGSEHLYGTERN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaatataccatccaaaatgactatattgctttgtcggtattagactatggattg
cgcataaaagaaatttttttgaagccgattcaacaaaatgctgttttagcttacgcggaa
aattccgaatatttacaggaagtcaattttctaggtgcgacaatcggtcccaatgctaac
cgtataaaggacggtaagttttccattgccggcactgaatggaattgggagaaaaatgat
ggggccaataatctgcacagcgggaaatacggtcttcacttaaaatattggcactgcagt
gttatcgaaaaccgtatacatgccaaatatttccaagaaataccgtttatgtgtgaatat
gaagctgtattcagtttgaataactcgcaaattgaagtggaatattttgccgtgccagac
gctcctgccctgataaacatgacgaatcacagttatttccaccttgatgcggcggcgacg
gtgctggattatcaactgaagctggcggccgatttctacactccccgcactgctgatggc
attcctaccggtgaaatacgtagtgtggccggcacggcactcgatttccgcgaatataaa
accattagcacgatgctggcagcggctcgccaaaccggtctgacaaaagaaggttttgac
cacaatctgcttgtagcgagcaagggattccgcttgttggcaagtgttttgacctcacgg
gttaagctagatattttttccgacgcccccggttttcaattttacacagctgaaaattta
atcagtcacggtagacgcacgccatataaagggctttgcatcgaaccgcaatacataccg
aacagcatcaattgtagttatttgaaacaacccgtattcacgggtgctcagccatttcat
caaaaaactgtctatgcttttgaatttcctgatactggcagcgagcatttgtatgggaca
gaacgcaattaa

DBGET integrated database retrieval system