KEGG   Clostridiales genomosp. BVAB3: HMPREF0868_0276Help
Entry
HMPREF0868_0276   CDS       T01181                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
clo  Clostridiales genomosp. BVAB3
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HMPREF0868_0276 (xylA)
   00051 Fructose and mannose metabolism
    HMPREF0868_0276 (xylA)
Enzymes [BR:clo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     HMPREF0868_0276 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1589122..1590444)
Genome map
AA seq 440 aa AA seqDB search
MKFFENVPKVKYEGSKSTNPFAFKYYNPEAVIAGKKMKDHLKFAMSWWHTMTATGQDQFG
SGTMSRIYDGQTEPLALAKARVDAAFDFMEKLNIEYFCFHDADLAPEGNSLQERNENLQE
MVSYLKQKMAGTSIKLLWGTSNCFSNPRFMHGAATSCEADVFAWTATQLKNAIDATIALG
GKGYVFWGGREGYETLLNTDVGLEMDNYARMLKMAVAYAHSKGYTGDFYIEPKPKEPTKH
QYDFDVATCVAFLEKYDLMRDFKVNIEANHATLAGHTFQHELRMARTFGVFGSVDANQGD
SNLGWDTDQFPGNIYDTTLAMYEILKAGGFTNGGLNFDAKVRRPSFTPEDIAYAYILGMD
TFALGLIKAQQLIEDGRIDRFVAEKYASYKSGIGAEILSGKTGLPELEAYALKKGEPKLY
SGRQEYLESVVNNVIFNGNL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttttgaaaatgtccctaaggtaaaatatgagggaagcaagtctaccaacccg
tttgcatttaagtattacaatcctgaagcggtgattgccggtaaaaaaatgaaggatcac
ctgaaattcgcgatgtcctggtggcacaccatgacggcgaccgggcaagaccagttcggt
tcggggacgatgagccgaatatatgacgggcaaactgaaccgctggccttggccaaagcc
cgagtggatgcggctttcgatttcatggaaaaattaaatatcgaatatttttgttttcat
gatgccgacttggctccagaaggtaacagtttgcaggaacgcaacgaaaatttgcaggaa
atggtgtcttacctgaaacaaaagatggccggaacttcgattaagcttttatggggaacc
tcgaattgtttcagcaaccctcgttttatgcacggggcagccacatcttgcgaagcggat
gtgtttgcttggaccgccactcagttgaaaaatgccatcgatgctaccatcgcgcttggc
ggtaaaggctatgttttctggggcggccgggaaggctatgaaaccttgctgaacactgat
gtcggcctggagatggataattatgcaagaatgctgaaaatggcggttgcatatgcgcat
tctaaaggttatacgggtgacttttatattgaacctaagccaaaagaacccactaaacat
caatatgatttcgatgtcgccacttgcgttgctttccttgaaaaatacgatttgatgcgt
gattttaaagtaaacattgaggctaatcacgctactttggccggtcatactttccaacat
gagttacgcatggcgcgtaccttcggggtattcggctcggttgatgccaatcagggcgac
agcaatctgggctgggataccgatcagttcccgggcaatatttatgatacgactttggcc
atgtatgagattttgaaggccggtggatttaccaacggaggcttgaactttgatgctaaa
gtgcgtcgtccgtcatttaccccggaagatattgcttatgcttatattttgggcatggat
acgtttgccttaggcttgattaaggcgcaacagctgattgaggatggcagaattgatcgt
ttcgtagcggaaaaatatgctagttataagtcgggcatcggtgctgaaatcttgagtggt
aaaaccggtttgccggaattggaggcttacgcattgaagaaaggcgagcctaagttgtat
agtgggcggcaggaatatcttgaaagtgtcgttaataacgtaattttcaacggaaatctt
tga

DBGET integrated database retrieval system