KEGG   Clostridiales genomosp. BVAB3: HMPREF0868_0499Help
Entry
HMPREF0868_0499   CDS       T01181                                 

Definition
putative threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
clo  Clostridiales genomosp. BVAB3
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:clo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0868_0499
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0868_0499
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HMPREF0868_0499
Enzymes [BR:clo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HMPREF0868_0499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1310654..1312396)
Genome map
AA seq 580 aa AA seqDB search
MRYISTRSDFSTESSAEVLINGILPDGGVLVPEYLPFYDEAGLAELAPLSFNERVVRILH
DFLPDFSPTRLRECVSKAFNKEAFPSERVVSVVGLNKYLQHEYLLEMWYGPTGSYKDIAI
QLYPELLNLAATSMGKNCRYCFINATCGDAGIAATAALKDFPHTEALILYPQRGLNEVQR
RQLLDGRGKNILIHPVNAGFDQIQILTKKICQSEEIRQAAVEAGKLVVTVNAKSWGRLLP
QVAVFVSAYADLLATGEITAHDKLNVVVPSGNLSNLLAAWYARQMGVPFRHLVCASNRNK
VTSDFFSSGKFDANRKLMHTIAPSMDILRPENMERLLFELSGHNYERVNAWELALSNDGG
YQVETDILRRIQAVMVGGFADDNAIMRTIREVYDRTDFAVDPHTAVGFNVYGRYEQRSKD
EAKVLYVSPTSPYKTPKVMSNALGLGKGAASVPETELISDLAKEIGVYLPKQLESLINAA
TPAATVAATAETATAIETNTNTAADNDNTKANVAATATVDETDVVAVDNIKANNMTAMSQ
SMSKPTSQPTSKLDVSEEPVSLTLQQVMPAVLEFVRHGCD
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgagatatatcagcacacgcagtgatttcagtaccgaaagttcagccgaagttttaatc
aacggcattttaccggatggcggggtattagtaccggaatatttaccgttttatgatgaa
gccggtttggccgagctggcaccactttcttttaacgaacgagttgtgcgcattttacac
gattttttgccggatttttcaccgactagattgcgcgagtgcgtaagcaaagcttttaac
aaggaagcatttccctctgaacgtgtagtttccgtggtaggattaaataagtatttgcaa
catgaatacctactcgaaatgtggtacggaccgaccggatcatataaagatattgcgata
caactatatcctgaactgctgaatttggccgctacctccatgggcaaaaattgtcgctac
tgctttatcaatgctacatgcggtgatgccggaattgccgctacagccgctttaaaggat
tttccacatactgaggcactcatcctctacccccaacgtggtttaaatgaagtgcaacga
cgacagttattggatggccgtggcaaaaatattcttattcacccggtaaacgcaggtttt
gatcaaatccaaattctgaccaaaaagatatgtcagtcggaggaaatccgacaagcggca
gtggaggcgggaaagttagtcgtaacagtaaacgccaagagctggggacggcttttaccc
caggtggcggtatttgtttcagcctatgctgacctgctggccacgggtgaaattacagcg
cacgacaaattgaatgtcgtcgttccgagtggtaatctcagcaatttactggcggcatgg
tatgcgcggcaaatgggggtgccgtttcgccatttggtctgtgcttccaaccgaaataaa
gttacttctgattttttcagcagcggcaagtttgatgccaaccgtaaattgatgcataca
atcgcgccgagcatggatattttgcgtccggaaaatatggagcggttgttgttcgagctg
agcggccataactatgagcgagtcaacgcttgggagcttgcgttaagcaatgacggcgga
tatcaggtggaaacggatatattgcgccgtattcaggcagttatggtcggtggttttgct
gatgacaatgctattatgcgcacgatcagggaagtatatgatcgaaccgactttgcggtt
gacccacatacggcggttggctttaatgtgtatggccgatacgaacaacgttccaaagat
gaagcgaaagtgctgtatgtttcgccaacaagcccgtataaaacgcctaaagtcatgtcc
aatgctttaggattgggtaagggggccgcttccgtgcctgaaaccgagctgatcagtgat
ctagcaaaagaaataggggtgtatttgccgaaacaactggagagcttaatcaatgcggct
acccctgctgcaacggttgcggccactgcagagacggctacggcgatcgaaactaatact
aataccgctgcggacaacgacaacaccaaggctaatgtggcggccacggctacggtggat
gaaactgatgttgtcgctgtggacaatatcaaggctaataatatgacggctatgtctcag
tctatgtctaagcccacgtctcagccgacatctaagctcgacgtcagtgaagagcctgtt
tcattgaccctacaacaggtcatgccggcggtgcttgaatttgtcagacacggctgcgat
taa

DBGET integrated database retrieval system