KEGG   Mageeibacillus indolicus: HMPREF0868_0499Help
Entry
HMPREF0868_0499   CDS       T01181                                 

Definition
(RefSeq) putative threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
clo  Mageeibacillus indolicus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:clo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HMPREF0868_0499
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0868_0499
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HMPREF0868_0499
Enzymes [BR:clo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HMPREF0868_0499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1310654..1312396)
Genome map
AA seq 580 aa AA seqDB search
MRYISTRSDFSTESSAEVLINGILPDGGVLVPEYLPFYDEAGLAELAPLSFNERVVRILH
DFLPDFSPTRLRECVSKAFNKEAFPSERVVSVVGLNKYLQHEYLLEMWYGPTGSYKDIAI
QLYPELLNLAATSMGKNCRYCFINATCGDAGIAATAALKDFPHTEALILYPQRGLNEVQR
RQLLDGRGKNILIHPVNAGFDQIQILTKKICQSEEIRQAAVEAGKLVVTVNAKSWGRLLP
QVAVFVSAYADLLATGEITAHDKLNVVVPSGNLSNLLAAWYARQMGVPFRHLVCASNRNK
VTSDFFSSGKFDANRKLMHTIAPSMDILRPENMERLLFELSGHNYERVNAWELALSNDGG
YQVETDILRRIQAVMVGGFADDNAIMRTIREVYDRTDFAVDPHTAVGFNVYGRYEQRSKD
EAKVLYVSPTSPYKTPKVMSNALGLGKGAASVPETELISDLAKEIGVYLPKQLESLINAA
TPAATVAATAETATAIETNTNTAADNDNTKANVAATATVDETDVVAVDNIKANNMTAMSQ
SMSKPTSQPTSKLDVSEEPVSLTLQQVMPAVLEFVRHGCD
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgagatatatcagcacacgcagtgatttcagtaccgaaagttcagccgaagttttaatc
aacggcattttaccggatggcggggtattagtaccggaatatttaccgttttatgatgaa
gccggtttggccgagctggcaccactttcttttaacgaacgagttgtgcgcattttacac
gattttttgccggatttttcaccgactagattgcgcgagtgcgtaagcaaagcttttaac
aaggaagcatttccctctgaacgtgtagtttccgtggtaggattaaataagtatttgcaa
catgaatacctactcgaaatgtggtacggaccgaccggatcatataaagatattgcgata
caactatatcctgaactgctgaatttggccgctacctccatgggcaaaaattgtcgctac
tgctttatcaatgctacatgcggtgatgccggaattgccgctacagccgctttaaaggat
tttccacatactgaggcactcatcctctacccccaacgtggtttaaatgaagtgcaacga
cgacagttattggatggccgtggcaaaaatattcttattcacccggtaaacgcaggtttt
gatcaaatccaaattctgaccaaaaagatatgtcagtcggaggaaatccgacaagcggca
gtggaggcgggaaagttagtcgtaacagtaaacgccaagagctggggacggcttttaccc
caggtggcggtatttgtttcagcctatgctgacctgctggccacgggtgaaattacagcg
cacgacaaattgaatgtcgtcgttccgagtggtaatctcagcaatttactggcggcatgg
tatgcgcggcaaatgggggtgccgtttcgccatttggtctgtgcttccaaccgaaataaa
gttacttctgattttttcagcagcggcaagtttgatgccaaccgtaaattgatgcataca
atcgcgccgagcatggatattttgcgtccggaaaatatggagcggttgttgttcgagctg
agcggccataactatgagcgagtcaacgcttgggagcttgcgttaagcaatgacggcgga
tatcaggtggaaacggatatattgcgccgtattcaggcagttatggtcggtggttttgct
gatgacaatgctattatgcgcacgatcagggaagtatatgatcgaaccgactttgcggtt
gacccacatacggcggttggctttaatgtgtatggccgatacgaacaacgttccaaagat
gaagcgaaagtgctgtatgtttcgccaacaagcccgtataaaacgcctaaagtcatgtcc
aatgctttaggattgggtaagggggccgcttccgtgcctgaaaccgagctgatcagtgat
ctagcaaaagaaataggggtgtatttgccgaaacaactggagagcttaatcaatgcggct
acccctgctgcaacggttgcggccactgcagagacggctacggcgatcgaaactaatact
aataccgctgcggacaacgacaacaccaaggctaatgtggcggccacggctacggtggat
gaaactgatgttgtcgctgtggacaatatcaaggctaataatatgacggctatgtctcag
tctatgtctaagcccacgtctcagccgacatctaagctcgacgtcagtgaagagcctgtt
tcattgaccctacaacaggtcatgccggcggtgcttgaatttgtcagacacggctgcgat
taa

DBGET integrated database retrieval system