KEGG   Clostridiales genomosp. BVAB3: HMPREF0868_0499Help
Entry
HMPREF0868_0499   CDS       T01181                                 

Definition
putative threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
clo  Clostridiales genomosp. BVAB3
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:clo01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:clo00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:clo00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1310654..1312396)
Genome map
AA seq 580 aa AA seqDB search
MRYISTRSDFSTESSAEVLINGILPDGGVLVPEYLPFYDEAGLAELAPLSFNERVVRILH
DFLPDFSPTRLRECVSKAFNKEAFPSERVVSVVGLNKYLQHEYLLEMWYGPTGSYKDIAI
QLYPELLNLAATSMGKNCRYCFINATCGDAGIAATAALKDFPHTEALILYPQRGLNEVQR
RQLLDGRGKNILIHPVNAGFDQIQILTKKICQSEEIRQAAVEAGKLVVTVNAKSWGRLLP
QVAVFVSAYADLLATGEITAHDKLNVVVPSGNLSNLLAAWYARQMGVPFRHLVCASNRNK
VTSDFFSSGKFDANRKLMHTIAPSMDILRPENMERLLFELSGHNYERVNAWELALSNDGG
YQVETDILRRIQAVMVGGFADDNAIMRTIREVYDRTDFAVDPHTAVGFNVYGRYEQRSKD
EAKVLYVSPTSPYKTPKVMSNALGLGKGAASVPETELISDLAKEIGVYLPKQLESLINAA
TPAATVAATAETATAIETNTNTAADNDNTKANVAATATVDETDVVAVDNIKANNMTAMSQ
SMSKPTSQPTSKLDVSEEPVSLTLQQVMPAVLEFVRHGCD
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgagatatatcagcacacgcagtgatttcagtaccgaaagttcagccgaagttttaatc
aacggcattttaccggatggcggggtattagtaccggaatatttaccgttttatgatgaa
gccggtttggccgagctggcaccactttcttttaacgaacgagttgtgcgcattttacac
gattttttgccggatttttcaccgactagattgcgcgagtgcgtaagcaaagcttttaac
aaggaagcatttccctctgaacgtgtagtttccgtggtaggattaaataagtatttgcaa
catgaatacctactcgaaatgtggtacggaccgaccggatcatataaagatattgcgata
caactatatcctgaactgctgaatttggccgctacctccatgggcaaaaattgtcgctac
tgctttatcaatgctacatgcggtgatgccggaattgccgctacagccgctttaaaggat
tttccacatactgaggcactcatcctctacccccaacgtggtttaaatgaagtgcaacga
cgacagttattggatggccgtggcaaaaatattcttattcacccggtaaacgcaggtttt
gatcaaatccaaattctgaccaaaaagatatgtcagtcggaggaaatccgacaagcggca
gtggaggcgggaaagttagtcgtaacagtaaacgccaagagctggggacggcttttaccc
caggtggcggtatttgtttcagcctatgctgacctgctggccacgggtgaaattacagcg
cacgacaaattgaatgtcgtcgttccgagtggtaatctcagcaatttactggcggcatgg
tatgcgcggcaaatgggggtgccgtttcgccatttggtctgtgcttccaaccgaaataaa
gttacttctgattttttcagcagcggcaagtttgatgccaaccgtaaattgatgcataca
atcgcgccgagcatggatattttgcgtccggaaaatatggagcggttgttgttcgagctg
agcggccataactatgagcgagtcaacgcttgggagcttgcgttaagcaatgacggcgga
tatcaggtggaaacggatatattgcgccgtattcaggcagttatggtcggtggttttgct
gatgacaatgctattatgcgcacgatcagggaagtatatgatcgaaccgactttgcggtt
gacccacatacggcggttggctttaatgtgtatggccgatacgaacaacgttccaaagat
gaagcgaaagtgctgtatgtttcgccaacaagcccgtataaaacgcctaaagtcatgtcc
aatgctttaggattgggtaagggggccgcttccgtgcctgaaaccgagctgatcagtgat
ctagcaaaagaaataggggtgtatttgccgaaacaactggagagcttaatcaatgcggct
acccctgctgcaacggttgcggccactgcagagacggctacggcgatcgaaactaatact
aataccgctgcggacaacgacaacaccaaggctaatgtggcggccacggctacggtggat
gaaactgatgttgtcgctgtggacaatatcaaggctaataatatgacggctatgtctcag
tctatgtctaagcccacgtctcagccgacatctaagctcgacgtcagtgaagagcctgtt
tcattgaccctacaacaggtcatgccggcggtgcttgaatttgtcagacacggctgcgat
taa

DBGET integrated database retrieval system