KEGG   Clostridiales genomosp. BVAB3: HMPREF0868_0538Help
Entry
HMPREF0868_0538   CDS       T01181                                 

Gene name
adh2
Definition
aldehyde-alcohol dehydrogenase 2 (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
clo  Clostridiales genomosp. BVAB3
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:clo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HMPREF0868_0538 (adh2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0868_0538 (adh2)
   00620 Pyruvate metabolism
    HMPREF0868_0538 (adh2)
   00650 Butanoate metabolism
    HMPREF0868_0538 (adh2)
  Lipid metabolism
   00071 Fatty acid degradation
    HMPREF0868_0538 (adh2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    HMPREF0868_0538 (adh2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HMPREF0868_0538 (adh2)
   00626 Naphthalene degradation
    HMPREF0868_0538 (adh2)
Enzymes [BR:clo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HMPREF0868_0538 (adh2)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     HMPREF0868_0538 (adh2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1277605..1280250
Genome map
AA seq 881 aa AA seqDB search
MKETNAQVPEISSAQAEVNALVAKAKVALSEFYAYDQEKIDYIVAKCSVAALDKHGELAR
LAIEETKRGVFEDKATKNLFACEYVVNHMRHLKTVGIIKEDPVEELYYVAEPLGVIAGVT
PVTNPTSTAIFKSLIALKTRNPIVFAFHPSAQKSSAAAAKIVYDTAVAAGAPLNCIQWIE
TPTMEGTTALMHHPDVATILATGGNAMVRAAYSCGKPALGVGAGNVPAYIEASANLRQAI
NDVVMSKTFDNGMICASEQAIIVDQPIYNEAIELLKTYKAHICNKKEKALVEKFAFGVNS
YTDEAPNAKLNPDMVGQTAAWIAEKAGFSVPEDTSILICECKEVGPQEPLTREKLSPVLA
LLVAKSPADGLDKAEAMVEFNGLGHTACIHTKNDELVREFGTRLKACRICVNSPSTLGGI
GNVYNNMIPSLTLGCGSYGHNSVSDNISAVNLLNIKKIGKRRNNMQWFKVPSKIYFEKNA
ITYLHDMRNVERVFIVTDRAMVDLGYVDRITEQLHKRRNNVKIQLFCDVEPDPDITTVKR
GLSLMHAFRPDTIVALGGGSSMDAAKGMWLFYEQPDVNFDDLKQKFMDIRKRAFRYPELG
KKSKLVCIPTTSGTGSEVTPFAVISDKANGKKYPLTDYSLTPTVAIVDPALVMTLPKTVT
ADTGMDVLTHALEAYVSILASDYTDALALQVIRMVFKYLPRAVHLGAKDEEAREKMHNAS
TMAGMAFANAFLGISHSLAHKIGAEFHGVHGRINAALLPFVVKFNGTQPSKPGIWPKYKY
YDADERYADVARMLGLEFNTKEEGVAKLAEAIYNLGRECDVQMSFREQGISKDDWDAAME
KIAYLAYEDQCSPANPRTPIVSEMIKEILIPAYDGYMPFNK
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaacgaacgcacaagtaccggaaatcagctcggcccaagccgaggttaacgct
ctggttgctaaggcaaaagttgctctgagtgaattttacgcttacgatcaggaaaagatt
gattacatcgtagctaaatgttccgtagccgctttggacaaacacggcgaattggccaga
ttggctatagaggaaacaaagcgcggtgtattcgaggataaggccaccaagaatcttttc
gcctgtgagtatgtagtaaaccacatgcgccatctcaaaactgtcggcattattaaagaa
gacccagttgaagaactgtattacgttgctgaaccactaggcgttatcgccggtgtaact
ccggtaaccaatccgacttcaacagctattttcaaatctttaattgctctgaaaacgcgt
aatccgattgtctttgcgtttcatccaagtgcgcagaaatcttccgctgccgccgccaag
attgtgtacgacacagctgtcgccgccggtgctcccctgaactgcattcaatggattgag
actcctaccatggagggaacaaccgctcttatgcatcaccctgatgtggcgacgattctc
gctaccggtggtaatgcaatggtgcgcgcggcttacagttgcggtaagccggctttgggc
gtcggtgccggtaacgtgccggcttatatcgaagccagtgcaaatttacgccaagcgatc
aacgacgtcgttatgtccaaaactttcgacaacggtatgatttgcgcttccgaacaggcg
ataattgttgatcaacccatttataacgaagccattgaactgctcaaaacatacaaagca
catatatgtaacaagaaagaaaaggctttggtcgaaaaattcgctttcggcgtaaactct
tataccgatgaagctccgaacgctaagctcaatcctgacatggtcggacagaccgctgct
tggatcgccgaaaaagctggtttcagcgtcccggaagacacctccattctcatttgtgaa
tgcaaagaagtcgggccacaagaacctctgacgcgtgagaaactgtcaccagtcctcgct
ttgttggtcgccaagtctcccgccgacggtctcgataaagcagaagcgatggttgagttt
aacggtctcggccataccgcctgcattcacaccaaaaacgatgagttggtacgtgaattt
ggcacccgtctgaaagcttgccgtatctgcgtcaattctccgtccacccttggcggtatc
ggtaatgtctataacaacatgattccatctcttaccttaggctgtggttcttacggccac
aactccgtcagcgacaacatcagtgccgtaaatctgctaaacattaaaaaaatcggaaaa
cggagaaataatatgcaatggttcaaagtgccgtctaaaatttactttgaaaagaacgcc
atcacctatctacatgacatgcgtaatgtagaacgtgttttcatcgtcaccgaccgtgca
atggttgatctagggtatgttgatcgcattactgaacaattacacaaacgccgcaacaat
gtcaaaattcaacttttctgcgacgttgagccggatccggatataacgacagtaaaacgc
ggcctgagtttgatgcacgcgttccggcctgataccatcgttgctttgggcggcggttct
tcaatggacgcagctaaaggtatgtggcttttctacgaacaacccgatgttaatttcgat
gatttgaagcaaaaattcatggatattcgtaagcgtgccttccgttatcctgaattgggc
aaaaagagcaagctcgtttgtattcctaccaccagcggtaccggcagcgaagtcacgcct
ttcgccgtaatcagtgataaggccaacggcaaaaaatatcctctgaccgattattcttta
accccaacagtcgccatcgtcgaccccgcgttagtcatgactctgccaaaaacggtaact
gccgataccggtatggatgttctgacccatgctttggaagcttatgtaagtatccttgcc
agcgactacaccgatgcgcttgccttgcaggtaattcgtatggtcttcaaatacttgccg
cgtgctgtccatctcggtgccaaagacgaagaagcacgtgaaaagatgcacaacgcttca
actatggccggtatggctttcgccaacgctttcctcggcataagccactctctcgcccac
aaaatcggtgcggaattccacggagttcacggccggataaatgccgccctgctgcctttt
gtcgtcaagtttaacggaactcagccttccaagcccggtatttggccgaaatacaagtat
tatgatgccgatgaaagatatgctgatgtcgctcgtatgctaggcttagaattcaatacc
aaagaagagggcgtggccaagcttgccgaggccatctacaacttaggccgcgaatgtgat
gtgcagatgtcattccgtgaacagggcataagcaaggatgattgggatgcggcaatggaa
aaaattgcttatctggcctatgaagatcaatgctcgccggccaatccgcgcacaccgatt
gtcagtgaaatgatcaaggaaatcttgattcccgcttacgatggttatatgccttttaac
aaataa

DBGET integrated database retrieval system