KEGG   Mageeibacillus indolicus: HMPREF0868_0610Help
Entry
HMPREF0868_0610   CDS       T01181                                 

Gene name
tpiA
Definition
(RefSeq) triose-phosphate isomerase (EC:5.3.1.1)
  KO
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
clo  Mageeibacillus indolicus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:clo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0868_0610 (tpiA)
   01230 Biosynthesis of amino acids
    HMPREF0868_0610 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0868_0610 (tpiA)
   00051 Fructose and mannose metabolism
    HMPREF0868_0610 (tpiA)
   00562 Inositol phosphate metabolism
    HMPREF0868_0610 (tpiA)
Enzymes [BR:clo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     HMPREF0868_0610 (tpiA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HMPREF0868_0610 (tpiA)
Exosome [BR:clo04147]
 Exosomal proteins
  Proteins found in most exosomes
   HMPREF0868_0610 (tpiA)
  Exosomal proteins of colorectal cancer cells
   HMPREF0868_0610 (tpiA)
  Exosomal proteins of bladder cancer cells
   HMPREF0868_0610 (tpiA)
  Exosomal proteins of melanoma cells
   HMPREF0868_0610 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1193551..1195506)
Genome map
AA seq 651 aa AA seqDB search
MAKLLKKSIEDIEVTGKRVIARVDFNVPQDKATGAITDDKRIRAALPTIQYLIDHGAKLI
LVSHLGRPKNGPEDKFSMRPVAARLSELLGKEVTLAKDVIGDDAKAKIAAMHDGDVVMLE
NVRFHKEETKNNPAFARELASLAEIFVNDAFGTAHRAHASTAGLANYLPSVCGFLIQKEL
KIMGDAINNPKRPLVAILGGAKVSDKIGVIENLIAKVDTLIIGGGMAYTFFAAKGYEVGK
SLLEADKIELAKGLLAKAEDKGVKLLLPVDTVVVKEFKADAAATVVASDAIPADQMGMDI
GPESVKLFKAAIADAGTVIWNGPMGVFEFDAFAVGTRAIAQAVSESGAISIIGGGDSAAA
IEKLGFADKVTHISTGGGASLEFLEGKVLPGIDCLMNSDNHRNLSAGNWKMNLGVPSQAV
KLLNELKPAVAGAEAEIVVGVPFTALSAALEATAYSNIKIAAQNCHYEEKGAFTGEVAVR
MLAEMGVPYVIIGHSERREYYAETNESVNKKVLAALSWGVRPIICCGETLAQRESGETFA
WIKEQITAALSGVPANKLHLVTVAYEPIWAIGTGKTATDAQAQEVCEYVRKLIAELYTAA
DADKVRILYGGSVNAKNVAGLYAQKDIDGGLVGGASLKSADFAVICNTYHA
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattattaaaaaaaagcattgaagacattgaggtaaccggcaagcgtgtgatt
gctcgggtagactttaacgtaccacaggacaaggccaccggcgcgatcacagatgacaaa
cgtatccgggccgccttgccgactattcaatatttgatcgatcatggcgcaaaacttatc
ttggtttcccatttgggacggcctaagaacggaccggaagacaagttttccatgcgtcca
gttgccgctaggttaagtgaattgctaggcaaggaagttactttggcgaaggatgtcatt
ggcgatgatgccaaggcaaaaattgccgccatgcatgacggcgatgtcgttatgttggaa
aatgtccgtttccacaaagaagaaaccaaaaataatcctgcttttgcccgggagttggct
tctttggctgaaattttcgttaacgatgcgttcggtaccgctcatcgcgcccacgcttca
accgccggtctggctaactatcttccgtcggtatgcggtttcctgatccaaaaagaattg
aagatcatgggtgatgccatcaacaatccgaagcgtcctttggttgccattttgggtgga
gccaaagtttcggacaagatcggtgttattgaaaacctgatcgcaaaagtggacacctta
attatcggtggtggtatggcttatacattctttgccgccaaagggtatgaagtcggcaag
tctttgctggaggctgacaaaatcgaattagctaaaggcttattggccaaggctgaagac
aaaggagtcaagctcctgttgccagttgataccgtagttgtcaaagaatttaaagctgat
gctgctgcgaccgttgttgcttccgatgccattcctgctgaccaaatgggtatggatatt
ggtcctgaaagtgttaaactcttcaaggctgccattgcagatgccggtacggtaatttgg
aatggacctatgggggtttttgaatttgatgcctttgctgttggtactcgtgctattgcc
caagcagtttccgagtccggggcaatttcaattatcggcggcggtgattcagcggctgcc
attgagaagctcggtttcgcggataaagttacccatatttctaccggtggcggagcttct
ttggaattccttgaaggcaaggttttgcccggcattgattgcctgatgaacagcgacaat
caccgcaatctgtcggccggtaactggaagatgaacctcggggtaccttcccaagcggta
aaactgcttaatgagcttaagccggcagtcgccggggcggaagcggagatcgttgttggc
gttccgtttactgccttaagtgccgctttggaagctacggcttattcaaatattaaaatt
gccgctcaaaactgccattatgaagaaaagggtgcgttcaccggtgaggttgccgtgcgc
atgctggcagaaatgggtgtgccttatgtcattatcgggcacagcgagagaagagaatat
tatgctgaaaccaatgaaagcgtaaataagaaggttttggcggctttgagttggggcgtt
cgcccgatcatctgctgcggtgaaactttagcccaacgtgaaagtggcgaaacattcgct
tggatcaaagaacagattaccgctgccttgtccggcgtaccggcaaacaagctgcatttg
gtaactgttgcttatgagccgatctgggcaatcggtaccggaaaaaccgccacagacgcc
caggcacaggaagtttgtgaatatgttcgcaagctcatcgctgaactgtatactgccgcg
gatgctgataaggtgagaatactgtacggcggtagcgtaaatgccaaaaatgtcgcggga
ttatatgcccaaaaggatattgacggcgggcttgtcggaggtgcttctctgaaatcggcc
gatttcgcggtgatttgcaacacctaccacgcataa

DBGET integrated database retrieval system