KEGG   Clostridiales genomosp. BVAB3: HMPREF0868_1026Help
Entry
HMPREF0868_1026   CDS       T01181                                 

Definition
hexokinase
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
clo  Clostridiales genomosp. BVAB3
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:clo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0868_1026
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0868_1026
   00051 Fructose and mannose metabolism
    HMPREF0868_1026
   00052 Galactose metabolism
    HMPREF0868_1026
   00500 Starch and sucrose metabolism
    HMPREF0868_1026
   00520 Amino sugar and nucleotide sugar metabolism
    HMPREF0868_1026
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HMPREF0868_1026
   00524 Butirosin and neomycin biosynthesis
    HMPREF0868_1026
Enzymes [BR:clo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     HMPREF0868_1026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
730575..731960
Genome map
AA seq 461 aa AA seqDB search
MNKLIEIFPTEVAERLPQVEDFLKKHNLLAEQYDFDGEKKRLIAAMRCGLEHKDSDMAML
PTYLGSEIRRDLPAETVLVLDIGGTNLRAGLVRVSGDETVLLKSKSCGLPGKNSNIDYLD
FLRELANFFKPYLSDEISRMAICFSFAADIEEDKTAKILAWSKEVKISDAAGRNLVRDLQ
AVCREQGLPVLPMRVANDSTAALLSILQTTAKNNYSGPIGIIHGTGFNCALPTAAWPKLA
GSYPLNMLVNTEMGNYTIGNRGDIDRYLDEISTLPNDHVLEKLLSGEYLGKLSGMTILAA
AGVKSAFHGHDDIVSGKPILNICNCNSDVIEEFTRLSNASVSMFLQNVSDYPEFWNRCFP
TEESRSVVRQLLAAIYERAAKLVTIVLAAVTAMLPQKSTAEGDLGKTAVLIEGSTYHKSF
ALADLFKYYLAKAGLADKYVFLSPRENANLLGTALSWHLAE
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaataaattaattgaaatatttcctacggaagttgctgaacgtctaccgcaagttgaa
gattttttgaaaaaacataatttgttagctgagcaatatgattttgatggcgaaaaaaag
aggcttattgcagcgatgcgttgtgggcttgagcataaagatagcgatatggcaatgtta
ccgacttacctcggcagtgagatcagacgagatttgccggctgagacggttttggtttta
gatattggcggtactaacttacgtgccggtttagtaagagttagcggagacgaaacagtt
ttgcttaaatcaaagtcttgcggtctgcctggcaaaaattcaaatattgactatctggat
tttttgagagaattggcgaattttttcaaaccctatctttccgatgaaatatcacgtatg
gcgatttgtttttcgtttgctgctgatattgaagaggataaaacagctaaaatattggcg
tggagcaaggaagttaaaatcagtgatgctgccggacgcaatttggtgcgagatttacag
gcggtttgtcgcgaacaaggcttaccggttttgcctatgcgagtcgctaatgattcaaca
gccgctttgctcagtattttgcagactacggctaaaaacaattattcaggtcctatcgga
attattcacggaacaggctttaattgtgctttacctactgctgcttggccgaaacttgct
ggttcgtatccgcttaacatgcttgtaaatacggaaatgggcaactacacgatcggtaat
cgcggggatattgatcgatacctggatgagatttcgactttgccgaatgatcatgtgctt
gaaaaattgttatcaggtgaatatttgggaaaattgagtggtatgacaattttggctgcg
gctggtgtgaaatcggccttccacgggcatgatgatattgtttcaggtaaacctattcta
aatatttgcaattgtaattcagatgtaattgaagaattcacacgtttatccaatgcttcc
gtatccatgtttttacaaaatgtttcggattatccggagttctggaatcgctgtttccct
actgaggaaagtagaagtgttgttcgacagctactggcggctatttatgaacgagcggca
aaactggtgacgatagtgcttgcagcggttactgcaatgctgccgcaaaaaagcactgca
gaaggagatcttggaaaaacggcagttttgattgaaggaagtacttatcataaatctttt
gctttggctgaccttttcaaatattatctggctaaggctggcttggctgataaatatgta
tttttatcaccgcgtgaaaatgccaatttgcttggcacggctttaagctggcatctggct
gagtga

DBGET integrated database retrieval system