KEGG   Mageeibacillus indolicus: HMPREF0868_1041Help
Entry
HMPREF0868_1041   CDS       T01181                                 

Definition
(GenBank) putative dipeptidase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
clo  Mageeibacillus indolicus
Pathway
clo00300  Lysine biosynthesis
clo01100  Metabolic pathways
clo01120  Microbial metabolism in diverse environments
clo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:clo00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    HMPREF0868_1041
Enzymes [BR:clo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     HMPREF0868_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADC90591
UniProt: D3R2D1
Position
complement(719304..720623)
Genome map
AA seq 439 aa AA seqDB search
MPVKTDSYYETMEKHLCELIRIPSVKSSPLPNAPFGLQTLQALEYMLNLGSSFGFTTKNL
DGYAGYIAFEAEKPLPYVAAVCHLDVVPAGDWEDAFKAVITDDKIIGRGSIDDKGPAMCC
LFALKALKDSGYKPAVTIRLVLGLDEESGSDCMEYYSANEPAPLAAFTADADFPVIFAEK
GNLHFSFSKQRPTNESDLQSLVAGTKANVVPGYCTYTAKGQTHTVIGEPAHASTPWLGKN
AISLAVQQLTTLPSINIERDSFINFFSKYFSATTDGSLLGIKCHDDLSGSLTCNAGVAEL
NPQAWSLECDIRYPVTFRSENIINVLEEVAAANECSFKVSSDSSPLIRDPSDPLVITLMD
IYRQLTGEAEAKPIAIGGGTYARDVKNCIAFGPVFPGEECICHQTGEFARRDTLKKAMNI
YAEAFFRLSKEDSLNPTAL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaaaaactgattcttattacgagacgatggaaaaacacttgtgcgaattaatt
cgtattcccagtgttaagtcatcacctttgcccaacgcacctttcggcttgcaaacactt
caagctttagagtatatgctaaatttaggcagttccttcggtttcacgaccaaaaatctc
gacggatatgctggttatatagcttttgaagcagagaaaccgttgccatatgtcgctgcg
gtttgccatttagatgttgtaccggccggtgattgggaagatgcttttaaagccgtaata
accgacgataaaataatcgggcgaggaagcatcgatgataaaggcccggccatgtgttgt
ctgttcgccctaaaagcactcaaagacagtggttacaaaccagccgtaaccattcgctta
gtacttggtctagatgaagaatctggctctgactgcatggaatattattctgccaacgag
cctgctcccttagcagcatttacggcggatgccgacttcccagttatttttgcagaaaag
ggtaatttgcatttttctttcagtaaacagcgcccaacaaatgaatctgacctgcagagc
ctggttgcggggactaaagccaatgttgttcccggttattgcacctacacggctaaaggc
cagacccacaccgttatcggcgaacctgcccatgcttccactccctggctgggtaaaaat
gccattagtttggcggttcaacaactcaccaccctcccttcaattaatattgagcgagat
tcttttataaacttcttcagtaaatacttctcggcaacaaccgatggttcacttctcggg
ataaaatgccacgacgatctgtccggcagcttaacctgcaatgccggcgtagctgagctt
aacccgcaagcttggtctttagaatgtgatattcgctaccctgtaacttttcgctcggaa
aatatcatcaatgtattggaagaagttgccgcagcaaatgaatgttcctttaaagtcagc
tctgattcgtcccctctaattcgcgatccaagcgatcctttagttattacgcttatggat
atatatcgccaattaaccggcgaagccgaagcgaaacctattgcaatcgggggaggtaca
tatgcacgggatgttaaaaactgcatagcctttggaccggttttcccaggcgaagaatgt
atttgccaccaaactggcgagttcgcccggcgtgataccctaaaaaaagcgatgaacatt
tatgcggaggctttcttccgcttgtctaaagaagactcattaaatcctactgcactttaa

DBGET integrated database retrieval system