KEGG   Clostridiales genomosp. BVAB3: HMPREF0868_1041Help
Entry
HMPREF0868_1041   CDS       T01181                                 

Definition
putative dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
clo  Clostridiales genomosp. BVAB3
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:clo01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:clo00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(719304..720623)
Genome map
AA seq 439 aa AA seqDB search
MPVKTDSYYETMEKHLCELIRIPSVKSSPLPNAPFGLQTLQALEYMLNLGSSFGFTTKNL
DGYAGYIAFEAEKPLPYVAAVCHLDVVPAGDWEDAFKAVITDDKIIGRGSIDDKGPAMCC
LFALKALKDSGYKPAVTIRLVLGLDEESGSDCMEYYSANEPAPLAAFTADADFPVIFAEK
GNLHFSFSKQRPTNESDLQSLVAGTKANVVPGYCTYTAKGQTHTVIGEPAHASTPWLGKN
AISLAVQQLTTLPSINIERDSFINFFSKYFSATTDGSLLGIKCHDDLSGSLTCNAGVAEL
NPQAWSLECDIRYPVTFRSENIINVLEEVAAANECSFKVSSDSSPLIRDPSDPLVITLMD
IYRQLTGEAEAKPIAIGGGTYARDVKNCIAFGPVFPGEECICHQTGEFARRDTLKKAMNI
YAEAFFRLSKEDSLNPTAL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaaaaactgattcttattacgagacgatggaaaaacacttgtgcgaattaatt
cgtattcccagtgttaagtcatcacctttgcccaacgcacctttcggcttgcaaacactt
caagctttagagtatatgctaaatttaggcagttccttcggtttcacgaccaaaaatctc
gacggatatgctggttatatagcttttgaagcagagaaaccgttgccatatgtcgctgcg
gtttgccatttagatgttgtaccggccggtgattgggaagatgcttttaaagccgtaata
accgacgataaaataatcgggcgaggaagcatcgatgataaaggcccggccatgtgttgt
ctgttcgccctaaaagcactcaaagacagtggttacaaaccagccgtaaccattcgctta
gtacttggtctagatgaagaatctggctctgactgcatggaatattattctgccaacgag
cctgctcccttagcagcatttacggcggatgccgacttcccagttatttttgcagaaaag
ggtaatttgcatttttctttcagtaaacagcgcccaacaaatgaatctgacctgcagagc
ctggttgcggggactaaagccaatgttgttcccggttattgcacctacacggctaaaggc
cagacccacaccgttatcggcgaacctgcccatgcttccactccctggctgggtaaaaat
gccattagtttggcggttcaacaactcaccaccctcccttcaattaatattgagcgagat
tcttttataaacttcttcagtaaatacttctcggcaacaaccgatggttcacttctcggg
ataaaatgccacgacgatctgtccggcagcttaacctgcaatgccggcgtagctgagctt
aacccgcaagcttggtctttagaatgtgatattcgctaccctgtaacttttcgctcggaa
aatatcatcaatgtattggaagaagttgccgcagcaaatgaatgttcctttaaagtcagc
tctgattcgtcccctctaattcgcgatccaagcgatcctttagttattacgcttatggat
atatatcgccaattaaccggcgaagccgaagcgaaacctattgcaatcgggggaggtaca
tatgcacgggatgttaaaaactgcatagcctttggaccggttttcccaggcgaagaatgt
atttgccaccaaactggcgagttcgcccggcgtgataccctaaaaaaagcgatgaacatt
tatgcggaggctttcttccgcttgtctaaagaagactcattaaatcctactgcactttaa

DBGET integrated database retrieval system