KEGG   Clostridiales genomosp. BVAB3: HMPREF0868_1058Help
Entry
HMPREF0868_1058   CDS       T01181                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
clo  Clostridiales genomosp. BVAB3
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:clo00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:clo00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(698554..699099)
Genome map
AA seq 181 aa AA seqDB search
MTEIYNYSVKNQKGEDISLNQFKGKVLLIVNTATGCGFTPQYKKLEEIFEKYHYQGFEII
DIPCNQFAGQTPGTDEEITNFCTLKYGTKFPQMAKSNVNGDDALPLFEYLKSQKGFSGFG
KGPKALMMSVMLKKIDKDYKNNPDIKWNFTKFLVDRDGNVVSRFEPTESMHEVAKAVESL
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaatttataattatagcgttaaaaaccaaaagggtgaagatatttctttaaat
caattcaaaggaaaagtattattgatagtaaacacagcaacaggttgcgggtttactcct
caatataaaaaattagaagaaatatttgaaaaatatcattaccaaggatttgaaataata
gatatcccttgtaatcaatttgcaggtcaaacacctggaactgatgaagaaataactaat
ttttgcacgctaaagtatggtacaaagttcccacaaatggctaaatccaatgtaaatggt
gatgatgctttaccattatttgagtatttaaaaagccaaaaaggattttctggatttgga
aaaggaccaaaagcattgatgatgtcagtaatgttaaaaaagattgataaagattataaa
aataatccagatatcaaatggaattttacaaagtttttagtagatcgtgatggaaatgta
gtttctcgttttgaaccaactgaaagcatgcatgaagttgcaaaagcagttgaatcatta
ttatga

DBGET integrated database retrieval system