KEGG   Mageeibacillus indolicus: HMPREF0868_1058Help
Entry
HMPREF0868_1058   CDS       T01181                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
clo  Mageeibacillus indolicus
Pathway
clo00480  Glutathione metabolism
clo00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:clo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    HMPREF0868_1058
  Metabolism of other amino acids
   00480 Glutathione metabolism
    HMPREF0868_1058
Enzymes [BR:clo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     HMPREF0868_1058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF1953 SCO1-SenC
Motif
Other DBs
NCBI-ProteinID: ADC91630
UniProt: D3R2E7
Position
complement(698554..699099)
Genome map
AA seq 181 aa AA seqDB search
MTEIYNYSVKNQKGEDISLNQFKGKVLLIVNTATGCGFTPQYKKLEEIFEKYHYQGFEII
DIPCNQFAGQTPGTDEEITNFCTLKYGTKFPQMAKSNVNGDDALPLFEYLKSQKGFSGFG
KGPKALMMSVMLKKIDKDYKNNPDIKWNFTKFLVDRDGNVVSRFEPTESMHEVAKAVESL
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaatttataattatagcgttaaaaaccaaaagggtgaagatatttctttaaat
caattcaaaggaaaagtattattgatagtaaacacagcaacaggttgcgggtttactcct
caatataaaaaattagaagaaatatttgaaaaatatcattaccaaggatttgaaataata
gatatcccttgtaatcaatttgcaggtcaaacacctggaactgatgaagaaataactaat
ttttgcacgctaaagtatggtacaaagttcccacaaatggctaaatccaatgtaaatggt
gatgatgctttaccattatttgagtatttaaaaagccaaaaaggattttctggatttgga
aaaggaccaaaagcattgatgatgtcagtaatgttaaaaaagattgataaagattataaa
aataatccagatatcaaatggaattttacaaagtttttagtagatcgtgatggaaatgta
gtttctcgttttgaaccaactgaaagcatgcatgaagttgcaaaagcagttgaatcatta
ttatga

DBGET integrated database retrieval system