KEGG   Clostridiales genomosp. BVAB3: HMPREF0868_1241Help
Entry
HMPREF0868_1241   CDS       T01181                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
clo  Clostridiales genomosp. BVAB3
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:clo00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
511232..512755
Genome map
AA seq 507 aa AA seqDB search
MKSRYSGVLLHIASLSGPYGCGTMGVEAVDFLKKLKKAGFSYWQVLPLTIVDEFHSPYKS
LSAFAGNPALIDPRGLVSDGLLTAAEAEACIYPQTASNMNYETAMATADKFLNLAFSRVT
AKLRQHISSFITKESAWLTDYACFITAKRTFNLLPWWEWPDKALAAHEPQAVADFMQKHQ
EEIDRCYFEQWVFNRQWSGLHKQARELGIGIIGDIPFYVDGDSADVWSHRELFAMESMKF
TEVAGVPPDYFSPTGQLWGNPIYDWFAHQKENFAWWKLRMQHALEAFDKLRIDHFRALVT
FWAIPYGSPDATSGEWRQAPYMEFYRQVFGNWPAERIFAEDLGDIDAKTREGIDAAGLAN
MKVLQFVFNIGGVKDDLPHNWEYPTVAYTGTHDNTTLIGWIWEMDDELRRYVLDYADFPA
DADWGKGGFNSPLVRRMLRVLWQSAAKLTVAQVQDLCGFGGDTRMNLPGRKENNWSYRLP
FGTTEHIDWDYFAKLNKLYQRNTPADD
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcaggtatagcggagttttgctgcacattgctagcttgtccggcccttatggt
tgtggaacgatgggggtagaagcggttgattttctgaaaaaactcaaaaaagcaggattt
tcctattggcaagttcttccattgactatcgtcgatgaatttcacagcccgtataagtca
ttatccgcctttgccggcaatccggctttgatcgatccacgtgggttggtatctgacgga
ttacttacggcggcggaagcggaagcgtgtatttatccgcaaacagcctcaaatatgaac
tatgaaacggctatggcaacagctgataaatttttgaatcttgcttttagccgggtgacc
gccaaacttcgccagcatataagttctttcatcactaaagaatctgcatggcttacggat
tatgcctgcttcataacagcaaaacgcactttcaatttgttgccctggtgggaatggccg
gacaaagctctggcggcgcatgagccgcaagcggtagctgatttcatgcaaaaacaccaa
gaggaaattgaccgctgctattttgaacaatgggtgtttaaccgccagtggagcggccta
cacaaacaagctcgcgaactcggtattgggataatcggtgatattccgttttatgttgat
ggagattcggccgatgtgtggtcgcatcgagagctttttgccatggaaagcatgaaattt
actgaagtggcaggcgtacccccggattatttttcgccaacggggcaattgtggggtaac
ccgatatatgactggtttgcccaccaaaaggagaattttgcttggtggaagttgcgtatg
caacacgccctagaggcttttgataaactgagaattgaccatttcagagccttggtaact
ttctgggcgattccttacggcagccctgatgcaacttcaggcgaatggcggcaggcccct
tatatggaattttatcgtcaggtttttggtaactggccggcggaacgtatttttgcggaa
gatctgggtgacatagatgccaagactcgtgaaggtattgatgcggctggattggccaac
atgaaagtgttgcaatttgtgtttaacatcggtggggtaaaggacgatttgccgcacaat
tgggaatatccgacggttgcgtatactggaactcatgacaataccactttgatcggttgg
atttgggaaatggatgacgagctccgtcgctatgtgcttgattatgcagattttccggct
gatgccgactggggcaaaggcggattcaacagtccgttggttcggcgtatgttaagggtt
ttgtggcaatcggcagcgaaattgaccgtggctcaggtgcaggatttatgcggtttcggc
ggcgatacaagaatgaacttgccgggacggaaagaaaataactggagctatcgtctgcca
ttcggcacaacagagcatatcgactgggattattttgcgaagttgaataagctttatcag
cgcaacactccggccgacgattga

DBGET integrated database retrieval system