KEGG   Clostridiales genomosp. BVAB3: HMPREF0868_1298Help
Entry
HMPREF0868_1298   CDS       T01181                                 

Definition
putative 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
clo  Clostridiales genomosp. BVAB3
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HMPREF0868_1298
Enzymes [BR:clo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     HMPREF0868_1298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
452876..453943
Genome map
AA seq 355 aa AA seqDB search
MIVKRNDGNNIIDFTVKAPAKLNLTLDISGKRSDGFHLLRSYFHTVALADDILVKIETCR
GDSLPSETIRANRQATIKDKNTYGINLLIGDELWLIDLQIRGEFAVPASGNNTIIKVFRE
LADRLRSDNEHSLLEATKYVRRCRIELTKNIPNEAGLGGGSSDAAALIEVLANLKTENSQ
STFLPSSAAKKELATAIGMDVPFFLTGGMAEITGAGETVRQIEKTTELPVIIFKPETGIS
TAIAYKIYDQLKADETAPYRPDNDKFITNWLEADYGKALLYSGNAFEAILKLVMPEYIQL
LSYIRQQTDSASAHLSGSGSAGWIIPSDHKKCESILCALNKKKVWCKLTNLQKRI
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatagtaaaacgaaatgacggaaataatattattgattttactgtgaaagcgccggcc
aaattaaaccttactcttgatataagcggaaaacgatcggacggttttcatttgttgcga
tcatattttcatactgttgctttggccgacgacatacttgtaaaaatagaaacttgccgc
ggcgacagcttgccatcggaaaccatcagagcgaatcggcaggcaacaataaaagacaaa
aatacttacggaattaatctgcttatcggcgatgaattatggctaattgacttgcaaatt
aggggagaattcgctgtgccggcatccgggaacaacaccataatcaaagtttttcgggaa
ctggctgaccgcctaaggtccgacaatgaacatagcctgcttgaagcaacgaaatatgta
cgccgttgccgaatagagctgacaaaaaatatccccaacgaagctggtttaggcggcgga
tcatccgacgcggctgcactgattgaagttttggcgaatttgaaaactgaaaactcccag
tcgacatttttgccgtcaagtgctgccaaaaaagaattagccaccgcaatcggcatggac
gtgccgttttttctaactggcggtatggccgaaataaccggtgctggcgaaacggttcgc
caaattgagaaaacaacggaacttcctgttataattttcaaaccggaaactggcatttct
acagcaattgcatacaaaatatacgaccaactgaaagcggacgaaacagctccttatcga
cccgataacgacaaatttatcacgaactggttggaggctgactatggaaaagctttgcta
tatagtggcaacgccttcgaagcgattttaaaattagttatgcctgaatatatccagctt
ttaagctatatcagacagcagacagactcggctagcgctcatctaagtggcagtggcagt
gccggctggatcattccatctgaccacaaaaaatgcgaatcaattttatgcgcattaaat
aaaaagaaagtttggtgtaaactgacaaatttgcagaaacgaatttga

DBGET integrated database retrieval system