KEGG   Clostridiales genomosp. BVAB3: HMPREF0868_1440Help
Entry
HMPREF0868_1440   CDS       T01181                                 

Definition
putative porphobilinogen deaminase, dipyromethane cofactor binding domain-containing protein
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
clo  Clostridiales genomosp. BVAB3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HMPREF0868_1440
Enzymes [BR:clo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     HMPREF0868_1440
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HMPREF0868_1440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
294523..297363
Genome map
AA seq 946 aa AA seqDB search
MRSGGQAAKPAGAAGAVGAAKAAGAAGGDDFAAPADMSGVFGVSRVPESRDASKLPRSAD
LGRVDLLNGANKLGFTNNKAAVSQGAQGLRDAQAGQDGKGGKWSQSEITVQADNAVRPLR
LNTNGPLVRVGAIPWQIAVDRAEWVVSRLRRAGLPFHLTQVPVSGFDRHSIINKEDYYAS
PAQVEKVFDALLNRQIEIGVIALPELPQKLPAGIRVAAISEVVAAEYALVSLSDHPAGEH
DFIGVYSFSLARQLRSEKLGAHYEQRPYNFEQALTCLHEGVWGACAIPLADLIFDGCSSE
YSVEVLSKQRVVPPAGQGAVAVLVSDCEDELAAAVFSFLHNVETEKIYRLEIEIANLVSD
RKERAGSCIWSENNTYFMSLYNPRLERPFQRWLCKPISEPGKRINKQLCYSILHGVTGNV
HLIGIGSGAPKQLTIEAEYLLRRTDLVICRSPQAEQLFYLLPVKASILDIDSDARLEQMD
FLLEQIIDAWRKGLKIAVLIRGDGYLLSCGGVLAKSLIERRVPFQLTPGISISISGPSLA
GVPLIFPGRSPHAHLYDGSDPMLSTYRFDMTAGRQGTLLFYIVPSQGRYIASLLMRQGFS
AHTAVMFLARPGHPEQGCVVSTLAMLEHALSVPANEQPGLLIVGEIVRSHEVMDRTDSGY
KPLLGKSVLIPSIDNSDEREFAWQREWEEQGAHIIKLRLSAVLVDEDNKAVLRDLFDQIL
RGDLCLPSVIKVPATKHKERLFERDRHKNEPEQLNITPVWLAFLSSDAVTTFFDEYLASG
HDMRQLSGCAFAAPNDEVYRTLSEVGIQADYTAPGQTAEDLAGDMQRFLTSQDQILVFRG
AEDSEMMEIMLNMAKFRVRGVAIYHRQNSLPPADRLLRLFDEAEYIAFATVAVVNPFAYA
MAAAKLGHDALRNRPIRLLAADADVQEALLDRGFQVHGSFGYLADL
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtggaggacaagctgccaaacctgccggggccgccggggccgtcggggctgcc
aaagccgccggggctgccgggggggatgattttgccgcgccggctgatatgtccggtgtt
ttcggcgtttccagggtaccggaaagccgtgacgcaagtaaactcccgcgttcggctgac
cttggccgagtcgatttgcttaacggtgcaaataaacttggttttacaaacaataaggcg
gcggtttcacaaggggcgcaaggactgcgagatgcgcaagcggggcaggacggtaaaggt
ggtaaatggtcacaaagtgagataacggtgcaggcggataatgccgttcgccctttacgc
ttaaatacaaacggacctttagtgcgggtgggggctataccatggcagattgctgtcgac
cgagccgagtgggttgtcagccgtttgcgtcgcgccggcttaccttttcatttgactcag
gtgccggtgtcaggtttcgatcggcacagcataatcaacaaagaagattactacgcttcg
cctgcgcaagtggagaaagtatttgacgccctactgaatcggcagatagaaatcggcgtt
attgctttgccggaactgccgcaaaaactgccggcaggaatccgtgtggcggcgatcagt
gaagtggtagcggccgaatacgccctcgtttcgctgtctgatcacccggccggagaacac
gatttcatcggtgtatatagtttttccctggcgcggcagttacgcagcgaaaaacttggc
gcacattacgaacaaagaccgtataattttgaacaagccttaacgtgcttacatgaaggc
gtttggggtgcttgcgcgatcccgcttgccgacctgatatttgatggctgttcctctgaa
tattccgtagaagtgttgtctaaacagcgggtcgtaccaccggccgggcaaggagcggtg
gcggttttggtcagcgactgtgaagacgaattggcggctgctgttttttcgtttctccat
aatgtcgaaacggaaaaaatttatcgtctggaaattgaaatagctaacctagtgtcagac
cgcaaagaacgcgctggaagttgcatttggtcggaaaacaatacgtactttatgtcactt
tacaatccgcggctggaacggccgtttcaacgctggctttgcaagccgatcagtgagccg
ggaaaacgaattaataagcagctgtgctacagtattttgcacggtgttaccggcaatgtc
catttgattgggatcggttcaggggcgccaaaacagttaaccatagaagcagaatatctg
ttgcggcgaacggacttggttatttgccgttccccccaggcagaacagctgttttatttg
ttgccggtaaaagcgagcattttggatattgattctgacgcaagactggaacaaatggat
tttttgctggagcaaataattgatgcttggcgcaaaggtttgaaaatcgccgtgcttatc
cggggggatggctatctgctttcctgtggcggagttttggctaaaagcctgattgagcgg
cgtgtaccttttcaacttacgccgggaatttcaatcagcataagcggcccgtctttggcc
ggagtaccgcttatcttccccgggaggtcgccgcacgcgcatttgtacgatggtagtgat
ccaatgttgtcgacttaccgttttgatatgacggccgggcgacagggaactttgcttttt
tatatcgttccatcacaaggcagatatattgcatctttattaatgcgtcagggcttttcc
gcgcatacggcagtgatgtttttggcaaggccggggcatcctgagcaaggctgtgtcgtc
tcaactttggcaatgctggaacatgctttatccgtccccgcaaatgagcagcccggcttg
ttgattgtcggtgaaattgttcgctcgcacgaggttatggatcgcaccgacagcggttac
aaacctttgcttggtaaaagtgtgcttatcccgagcatagacaacagcgatgaacgtgaa
ttcgcgtggcaaagggaatgggaagaacagggggcgcatattattaaactgcggttgagt
gccgtgttggtggacgaggataacaaagctgtacttcgcgatctgttcgaccaaattttg
cgtggcgacctgtgtttgccgagtgtaataaaagtcccggcgactaagcataaggaacgg
ttgtttgaacgtgaccgacataaaaacgagcctgaacagctgaacatcaccccggtgtgg
ctggcctttttaagctccgatgcagttacaactttttttgacgagtacctagcatccgga
cacgatatgcgccaactcagcggttgcgcttttgccgcgcctaacgatgaagtgtatcgt
actttgagtgaggtcggaatacaggcggattatacggcgcccggtcagacggccgaagac
ttggccggcgatatgcaacgtttccttacctcgcaagatcagattctagttttccggggg
gcggaagacagcgaaatgatggaaataatgctgaatatggctaaatttcgcgtgcgaggc
gtggcgatatatcatcggcagaacagtttgccgccggccgaccgtttgttacggttgttt
gatgaagcggaatacatagcttttgcgactgtggcggtggttaatccgttcgcctatgcc
atggcggcggctaaattggggcatgacgcactgcgtaatcgaccgatcagacttttggcg
gccgatgccgacgtacaagaagctttgctggatcgcggctttcaggtgcatggcagtttc
ggctatttggctgatttgtga

DBGET integrated database retrieval system