KEGG   Chlamydia pneumoniae LPCoLN: CPK_ORF00164Help
Entry
CPK_ORF00164      CDS       T01859                                 

Gene name
folKP
Definition
folate synthesis bifunctional protein (EC:2.5.1.15 2.7.6.3)
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
clp  Chlamydia pneumoniae LPCoLN
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:clp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1225926..1227278)
Genome map
AA seq 450 aa AA seqDB search
MSEPRFVCLSLGSNLGNRFKNLQIARTLLGEQAVLGLRSSVILETEALLLPGSPPEWDLP
YFNSVLVGETTLSLRELLVTIKQIEKVVGRAEESPPWSPRTIDIDILLYGDESFCCDHTE
ITIPLSNLLSRPFLIALIASLCPYRRFCTQGSPYHNFTFGELAHHLPSPPGMIRRSLSPD
TMLMGVVNVTNDSMSDGGMFLDPEKAVAQAEKLFTEGAAVIDFGAQATNPKVKQFLSVDQ
EWERLEPVLRLLKETWSNRKQYPIISLDTFYPEIILRAMDIYPIQWINDVSGGSQSMAEV
ARDCELSLVMNHSSSLPVDPKNILSFSVPIGEQLLSWGEKQLKMFSDVGLNANQVIFDPG
IGFGKGAAQSLATLYEIAKFKRLGCPILIGHSRKSFLSLFGNHDPKDRDWETVGLSILLQ
QQGVDYLRVHNVAAHQKALSVAACEACAPI
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagccccgttttgtctgcttaagtttaggatcaaatttaggaaatcgttttaaa
aatctacagattgctcgtactttattaggcgaacaagctgttttaggtctacgtagttcg
gtaattctagaaacagaagccttgttattaccgggatctcctccagagtgggaccttcct
tattttaattcggtacttgtaggggaaaccaccctatctttgcgagaactactggttact
atcaaacagatagagaaggtggtaggtagagcagaggagtcgcccccatggtctcctcga
acgatagatatagatattttgctttatggcgacgagtctttttgttgtgatcacaccgag
ataacgattcctttgtccaatttgttatcacgtccttttttgattgctttaatagcatct
ctttgtccttatcgtcgattttgcactcaaggttctccttatcacaactttacatttgga
gagttggcgcatcaccttccctcacctccagggatgattcgtaggagtttatctccagat
acgatgttgatgggggtggtaaatgtgactaacgactctatgtctgatgggggcatgttt
ttagatccagaaaaagcagtggctcaagctgagaagttatttacagagggcgctgcagtt
atagattttggagctcaagcaacaaaccctaaagtaaagcagtttttatctgtagatcaa
gaatgggagcgtctggagcctgttttaaggttgttaaaagagacttggtccaatagaaaa
caatatccaatcatctctttagatacgttttatcctgaaattattcttagggctatggat
atttatccgatccagtggattaatgatgtctctgggggatcacagtctatggctgaggtc
gctagagattgtgagctatccttggttatgaatcactcgtcttcgcttcctgtggatcct
aaaaatatcttgtcgttttctgtccctattggagagcaactgttgagctggggtgagaag
caacttaagatgttttctgatgttggtctgaacgcaaatcaggtgatttttgatcccggt
ataggttttgggaagggggctgcgcaatctttggctactttgtatgagattgcgaaattt
aagcgtttgggatgccctatccttattggacattctcgaaaatcgttcttatctttattt
ggtaatcatgatcccaaggatcgtgattgggaaaccgtaggtctatctatactcttacaa
caacaaggtgtggactacttgcgagtgcataatgttgctgctcatcaaaaagctttatca
gtagctgcttgtgaagcctgtgcacccatctaa

DBGET integrated database retrieval system