KEGG   Chlamydia pneumoniae LPCoLN: CPK_ORF00269Help
Entry
CPK_ORF00269      CDS       T01859                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
clp  Chlamydia pneumoniae LPCoLN
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:clp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPK_ORF00269 (gpmA)
   01230 Biosynthesis of amino acids
    CPK_ORF00269 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPK_ORF00269 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CPK_ORF00269 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CPK_ORF00269 (gpmA)
Enzymes [BR:clp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CPK_ORF00269 (gpmA)
Exosome [BR:clp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CPK_ORF00269 (gpmA)
  Exosomal proteins of melanoma cells
   CPK_ORF00269 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1101913..1102599
Genome map
AA seq 228 aa AA seqDB search
MALLILLRHGQSVWNEKNLFSGWVDIPLSQQGIEEAFSAGRAIQNLPIDCIFTSTLVRSL
MTALLAMTNHHSKKIPYIVHEDPKAKEMSRIYSAEEENNMIPLYQSSALNERMYGELQGK
NKKQTAEQFGEEQVKLWRRSYKTAPPQGESLYDTKQRTLPYFEKNILPQLQNRKNVFVSA
HGNSLRSLIMDLEKLSEEEVLSLELPTGKPVVYQWKNHKIEKHPEFFG
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggctcttcttattttattgcgtcatggacaatctgtatggaatgaaaaaaatttattt
tctggatgggtagacattcctttaagccaacagggaattgaagaggctttttccgcagga
agagctattcaaaatttgcctatagactgcatctttacctctaccttagtacgtagtctc
atgaccgccttactcgccatgacaaatcatcactctaagaagatcccctatattgttcat
gaagatcccaaagcaaaagagatgtcgaggatctacagtgcggaagaagaaaacaatatg
attcctctctatcaatctagtgccctcaacgaaagaatgtacggcgaacttcaaggaaaa
aataaaaaacaaacagctgaacagttcggagaagagcaggtcaagctgtggaggcgcagc
tacaaaacagctcctcctcagggagaaagcctctatgatacgaaacaaaggaccttgcct
tactttgaaaaaaatattttgcctcaactgcaaaatagaaaaaatgtttttgtttctgcg
cacggaaattccttacgctctttgattatggatctagaaaaattaagtgaggaagaggta
ctatctttagaattaccgacgggaaaaccagttgtatatcaatggaaaaaccacaaaatc
gaaaagcacccagaattttttggttaa

DBGET integrated database retrieval system