KEGG   Chlamydia pneumoniae LPCoLN: CPK_ORF00269Help
Entry
CPK_ORF00269      CDS       T01859                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
clp  Chlamydia pneumoniae LPCoLN
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:clp01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:clp01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:clp00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:clp00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:clp00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1101913..1102599
Genome map
AA seq 228 aa AA seqDB search
MALLILLRHGQSVWNEKNLFSGWVDIPLSQQGIEEAFSAGRAIQNLPIDCIFTSTLVRSL
MTALLAMTNHHSKKIPYIVHEDPKAKEMSRIYSAEEENNMIPLYQSSALNERMYGELQGK
NKKQTAEQFGEEQVKLWRRSYKTAPPQGESLYDTKQRTLPYFEKNILPQLQNRKNVFVSA
HGNSLRSLIMDLEKLSEEEVLSLELPTGKPVVYQWKNHKIEKHPEFFG
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggctcttcttattttattgcgtcatggacaatctgtatggaatgaaaaaaatttattt
tctggatgggtagacattcctttaagccaacagggaattgaagaggctttttccgcagga
agagctattcaaaatttgcctatagactgcatctttacctctaccttagtacgtagtctc
atgaccgccttactcgccatgacaaatcatcactctaagaagatcccctatattgttcat
gaagatcccaaagcaaaagagatgtcgaggatctacagtgcggaagaagaaaacaatatg
attcctctctatcaatctagtgccctcaacgaaagaatgtacggcgaacttcaaggaaaa
aataaaaaacaaacagctgaacagttcggagaagagcaggtcaagctgtggaggcgcagc
tacaaaacagctcctcctcagggagaaagcctctatgatacgaaacaaaggaccttgcct
tactttgaaaaaaatattttgcctcaactgcaaaatagaaaaaatgtttttgtttctgcg
cacggaaattccttacgctctttgattatggatctagaaaaattaagtgaggaagaggta
ctatctttagaattaccgacgggaaaaccagttgtatatcaatggaaaaaccacaaaatc
gaaaagcacccagaattttttggttaa

DBGET integrated database retrieval system