KEGG   Chlamydia pneumoniae LPCoLN: CPK_ORF00330Help
Entry
CPK_ORF00330      CDS       T01859                                 

Definition
inositol monophosphatase family protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
clp  Chlamydia pneumoniae LPCoLN
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:clp00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1031979..1032956
Genome map
AA seq 325 aa AA seqDB search
MHSELPNYQNIVESVVTEITTQLLNYRSEHRLVPFWEKSDGSFITAADYGSQYYLKQQLA
KAFPNIPFIGEETLYPDQDNEKIPEILKFTRLLTSSVSRDDLISTLVPPPSPTSLFWLVD
PIDGTAGFIRHRAFAVAISLIYEYRPILSVMACPAYNQTFKLYSAAKGHGLSIVHSQNLD
RRFVYADRKQTKQFCEASLAALNQQHHATRKLSLGLPNTPSPRRVESQYKYALVAEGAVD
FFIRYPFIDSPARAWDHVPGAFLVEEAGGRVTDALGAPLEYRKESLVLNNHAVILASGDQ
ETHETTLAALQNQLNVVPTDKLIAL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcactccgagttgcctaactatcagaacatcgttgagtctgtagttacggaaatcact
acacaactactaaactatcgaagcgagcaccgtttggttcctttttgggaaaaatccgat
ggttcttttatcactgctgctgattacggcagtcaatattatctaaaacaacagcttgca
aaagcctttcccaatattccttttattggagaagaaactctatatcctgatcaagacaac
gaaaaaatccctgaaatcttaaaatttacacgcctgttaacttcttcagtctcaagagat
gacttaatttctaccctggtccctcctccatctccgacttctttattttggcttgtcgac
cctattgatggtactgcaggttttatcagacatcgtgcttttgccgttgctatatcacta
atttatgagtatcgaccgattttgtcggtcatggcatgccctgcctataatcagacattt
aaactatattcagcagctaaaggtcatggtctttctattgttcattctcaaaatctagat
agacgctttgtttatgctgatagaaaacaaacaaaacaattctgtgaggcttcgttagct
gcattgaatcaacagcatcatgcaacacgtaagctaagcctgggtctccccaacactccg
agtcctcgtcgtgtagaaagccaatataagtatgctttagttgctgaaggcgccgtagat
tttttcattcgctacccttttattgattctcccgctcgtgcttgggatcacgtacctgga
gccttccttgttgaagaagctgggggtagagtcacagatgctttaggagcccctttagaa
tatagaaaagaaagtttggtcttaaataatcacgcagtgattcttgcttctggagaccag
gaaacccatgagacaacattagcagcgttacaaaaccaactcaatgttgtccccacggat
aagcttattgctctatga

DBGET integrated database retrieval system