KEGG   Chlamydia pneumoniae LPCoLN: CPK_ORF00387Help
Entry
CPK_ORF00387      CDS       T01859                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
clp  Chlamydia pneumoniae LPCoLN
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:clp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPK_ORF00387
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPK_ORF00387
   00640 Propanoate metabolism
    CPK_ORF00387
   00660 C5-Branched dibasic acid metabolism
    CPK_ORF00387
Enzymes [BR:clp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CPK_ORF00387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(967060..968220)
Genome map
AA seq 386 aa AA seqDB search
MHLHEYQAKDLLASYDVPIPPYWVVSSEEEGELLITKSGLDSAVVKVQVHAGGRGKHGGV
IVAKSSAGILQAVAKLLGMHFTSNQTADGFLPVEKVLISPLVAIQREYYVAVIMDRKHRC
PVLMLSKAGGMDVEEVAQSSPEQILTLPLTSYGHIYSYQLRQATKFMEWEGEVMHQGVQL
IKKLAKCFYENDVSLLEINPLVLTLEGELLVLDSKITIDDNALYRHPNLEVLYDPSQENV
RDVLAKQIGLSYIALSGNIGCIVNGAGLAMSTLDILKLHGGNAANFLDVGGGASQKQIQE
AVSLVLSDESVKVLFINIFGGIMDCSVVASGLVAVMETRDQVVPTVIRLEGTNVELGKEI
VQQSGIPCQFVSSMEEGARRAVELSM
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttcatgagtaccaagctaaagatctcttagcttcttacgatgtgcctattccc
ccctattgggtagtgtcttcagaggaagaaggggaacttcttatcacaaagtcgggatta
gattccgccgtggttaaagtacaggttcatgctggaggtcgagggaaacatggtggtgtc
attgttgcaaaatcctcagcaggcattttgcaagccgtagctaagctcttaggaatgcat
tttactagtaatcaaactgccgacggatttctccccgtagagaaagtcttgatttcacca
cttgttgctatacaaagggaatattatgtcgcagtgattatggatcgaaaacaccgatgc
ccagttcttatgctttcaaaagcaggaggtatggatgtcgaagaggtcgcacaatcttcc
ccagaacagatcctgacattaccactgacctcttatgggcatatctatagttatcaactt
cgtcaagccactaagttcatggagtgggaaggagaagtgatgcaccaaggtgtccaattg
atcaaaaagcttgcgaagtgcttttatgaaaatgatgtctctttattagagatcaatcct
ttggtgttgactttagagggtgagctacttgtcctcgattctaagattacgatcgatgac
aatgccctataccgtcatcccaacttagaagtattgtatgacccctctcaagagaatgtt
cgggatgtcctagcaaagcaaatcggattgtcctacatcgctctaagcggaaatatcggt
tgcattgtgaatggcgccggacttgccatgagtaccttagatattttaaagctccatggt
gggaatgctgcgaatttcttagatgtcggaggaggggcttctcaaaagcaaatccaagaa
gctgtatctttagtattgtccgatgagagcgtgaaagtgctttttatcaatatcttcggg
gggattatggactgttctgtagttgcctccgggctcgttgcagttatggaaacaagagat
caagtggttcctacagtcattcgtctcgaaggaacaaatgtagaattgggaaaagaaatt
gttcagcaatctgggattccttgccaatttgtctcttctatggaagagggcgctagacgc
gctgtagaactgagtatgtag

DBGET integrated database retrieval system