KEGG   Chlamydophila pneumoniae LPCoLN: CPK_ORF00387Help
Entry
CPK_ORF00387      CDS       T01859                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
clp  Chlamydophila pneumoniae LPCoLN
Pathway
clp00020  Citrate cycle (TCA cycle)
clp00640  Propanoate metabolism
clp01100  Metabolic pathways
clp01110  Biosynthesis of secondary metabolites
clp01120  Microbial metabolism in diverse environments
clp01130  Biosynthesis of antibiotics
clp01200  Carbon metabolism
Module
clp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:clp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPK_ORF00387
   00640 Propanoate metabolism
    CPK_ORF00387
   00660 C5-Branched dibasic acid metabolism
    CPK_ORF00387
Enzymes [BR:clp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CPK_ORF00387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACZ32863
Position
complement(967060..968220)
Genome map
AA seq 386 aa AA seqDB search
MHLHEYQAKDLLASYDVPIPPYWVVSSEEEGELLITKSGLDSAVVKVQVHAGGRGKHGGV
IVAKSSAGILQAVAKLLGMHFTSNQTADGFLPVEKVLISPLVAIQREYYVAVIMDRKHRC
PVLMLSKAGGMDVEEVAQSSPEQILTLPLTSYGHIYSYQLRQATKFMEWEGEVMHQGVQL
IKKLAKCFYENDVSLLEINPLVLTLEGELLVLDSKITIDDNALYRHPNLEVLYDPSQENV
RDVLAKQIGLSYIALSGNIGCIVNGAGLAMSTLDILKLHGGNAANFLDVGGGASQKQIQE
AVSLVLSDESVKVLFINIFGGIMDCSVVASGLVAVMETRDQVVPTVIRLEGTNVELGKEI
VQQSGIPCQFVSSMEEGARRAVELSM
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcatcttcatgagtaccaagctaaagatctcttagcttcttacgatgtgcctattccc
ccctattgggtagtgtcttcagaggaagaaggggaacttcttatcacaaagtcgggatta
gattccgccgtggttaaagtacaggttcatgctggaggtcgagggaaacatggtggtgtc
attgttgcaaaatcctcagcaggcattttgcaagccgtagctaagctcttaggaatgcat
tttactagtaatcaaactgccgacggatttctccccgtagagaaagtcttgatttcacca
cttgttgctatacaaagggaatattatgtcgcagtgattatggatcgaaaacaccgatgc
ccagttcttatgctttcaaaagcaggaggtatggatgtcgaagaggtcgcacaatcttcc
ccagaacagatcctgacattaccactgacctcttatgggcatatctatagttatcaactt
cgtcaagccactaagttcatggagtgggaaggagaagtgatgcaccaaggtgtccaattg
atcaaaaagcttgcgaagtgcttttatgaaaatgatgtctctttattagagatcaatcct
ttggtgttgactttagagggtgagctacttgtcctcgattctaagattacgatcgatgac
aatgccctataccgtcatcccaacttagaagtattgtatgacccctctcaagagaatgtt
cgggatgtcctagcaaagcaaatcggattgtcctacatcgctctaagcggaaatatcggt
tgcattgtgaatggcgccggacttgccatgagtaccttagatattttaaagctccatggt
gggaatgctgcgaatttcttagatgtcggaggaggggcttctcaaaagcaaatccaagaa
gctgtatctttagtattgtccgatgagagcgtgaaagtgctttttatcaatatcttcggg
gggattatggactgttctgtagttgcctccgggctcgttgcagttatggaaacaagagat
caagtggttcctacagtcattcgtctcgaaggaacaaatgtagaattgggaaaagaaatt
gttcagcaatctgggattccttgccaatttgtctcttctatggaagagggcgctagacgc
gctgtagaactgagtatgtag

DBGET integrated database retrieval system