KEGG   Chlamydia pneumoniae LPCoLN: CPK_ORF00488Help
Entry
CPK_ORF00488      CDS       T01859                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
clp  Chlamydia pneumoniae LPCoLN
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:clp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPK_ORF00488 (tpiA)
   01230 Biosynthesis of amino acids
    CPK_ORF00488 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPK_ORF00488 (tpiA)
   00051 Fructose and mannose metabolism
    CPK_ORF00488 (tpiA)
   00562 Inositol phosphate metabolism
    CPK_ORF00488 (tpiA)
Enzymes [BR:clp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CPK_ORF00488 (tpiA)
Exosome [BR:clp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CPK_ORF00488 (tpiA)
  Exosomal proteins of bladder cancer cells
   CPK_ORF00488 (tpiA)
  Exosomal proteins of melanoma cells
   CPK_ORF00488 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(857014..857778)
Genome map
AA seq 254 aa AA seqDB search
MTRQSYVLGNWKMHKTIQEAKEYVQTLASLLQGEPLSCTIGIAPPFTSLRAIHEMINTTG
AFLWLGAQNVHPELSGAFTGEISLPMLKEVGVEFVLVGHSERRHIFGESDAFIASKVKSV
AQAGLVPVLCVGESLEVREEGKAHQVIKKQLLLGLEQMDNGSEFLIAYEPVWAIGTGKVA
EASDVQDIHMFCREVVAERFSEATAEEISILYGGSVKVDNAQRFGQCSDVDGLLVGGASL
EAQSFFEVAKNFNV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggcagagttatgttttgggcaattggaaaatgcacaaaacaatccaagaggct
aaagagtatgttcaaacattagcttctttactacaaggagaacctctttcctgcactata
ggcatagctcctccatttacctctttgagagcgattcatgagatgataaacactacggga
gcttttctctggttgggagcacaaaatgtccatcccgagctttcgggtgcttttactgga
gaaatttctttacctatgcttaaggaggtaggagtggaatttgttttagtaggtcactcc
gagcgtcgtcatatttttggagagagtgatgcctttattgcttcaaaggtaaagtctgta
gctcaggcgggactcgtgcctgttctttgtgttggagagagcttagaagttcgtgaagag
ggaaaggcgcatcaggtaatcaaaaaacagttgcttttgggattggaacagatggataat
ggttccgaatttttgatcgcctatgaaccagtatgggctatcggcacagggaaggtggca
gaagcttcggatgtgcaagatattcatatgttttgtcgtgaggtagtggcagagaggttc
tcagaagctacagctgaagagatttcgattttgtacggaggatctgtgaaggtcgataat
gctcagcgatttgggcaatgtagcgacgtcgatggtcttttagttggcggagcttcttta
gaagcgcaaagtttttttgaagtcgctaaaaattttaatgtataa

DBGET integrated database retrieval system