KEGG   Chlamydia pneumoniae LPCoLN: CPK_ORF00635Help
Entry
CPK_ORF00635      CDS       T01859                                 

Definition
RecD/TraA family helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
clp  Chlamydia pneumoniae LPCoLN
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:clp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
689600..691798
Genome map
AA seq 732 aa AA seqDB search
MEKICGYLEQILVENKDSGDITAYIKIPNKTTPILIKGKLPQPLELGSPIQIYGVWSHSP
SNTKYFQIHSYDSPLLYEYRGVFHYLTSKLIKGIGPKIAEKIIEKFQEKTCYVLDITPER
LSEVSGISETRCVSICKQLCEQKILRKTLLFLQEYNIPIHYGVRIFKKYQEKSIEKICED
PFLLAREMEGIGFKTADFIAMKLGVPRNSESRLCAGIQHSLEELQEEGHTCYPIELLIDV
VAKLLNQDVFDTPITLEEIDTQILNMQKRKLLHIQDISGTLHVWTRYLHLAEKTIVSDLK
RILFSSRRIRSIDGEKAIAWVEENLSIDLAEQQREAIKACFSEKLLIITGGPGTGKSTIT
QAILKIFEQVTHKIILAAPTGKAAKRMTEITQKHSVTIHALLQYDFKTKSFRKNHDNPID
CDLIIVDESGMMDTHLLHHFLKALPDYTTLVFIGDIHQLPSVGPGNILKDLITSNKMTVI
RLNKIFRQVHDSGIVTNAHRVNEGELPILYSETGRRDFLFFQKDDQEEALNHIIHLVTKF
VPQKYHIYPQDIQVLAPMKKGTLGIYNLNKALKHALNPKKANLHGRFQSYAVGDKVMQIR
NNYNKEVFNGDIGYVSTINFEDKAVVVRMEGKHVGYSFSELDDLVLAYATSVHKYQGSES
PCIIIPIHTSHFMMLYRNLLYTAITRGKKLVILVGTKKAIAIATRNNRVQHRCTGLAEVL
KELDTKKNYADL
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaatctgcggatacttagagcaaatacttgttgaaaacaaagactctggggac
attactgcttatatcaaaatacccaataaaacgactcctatcctaattaaaggcaaactt
ccccaacctttggaactaggatccccaatccaaatctatggtgtctggagccattcccct
tcaaatactaagtatttccaaatccatagttacgactctcctcttctttatgaatatcgt
ggcgtattccattacctcacctcaaaactcatcaaaggaatcggccctaagatcgcagaa
aagatcatcgagaaatttcaagagaaaacatgttatgtcctcgatatcactccagaacgc
ttaagtgaggtttctggaattagcgaaacacgatgtgtctctatttgcaaacaactctgc
gagcaaaaaatcttaaggaaaactcttctctttctccaagaatacaatatcccgattcat
tatggagtgagaatttttaaaaaataccaagagaaatccatagaaaaaatttgcgaagat
cccttccttctagccagagaaatggagggcatcggattcaaaactgctgatttcatagct
atgaaactaggcgtccccagaaattctgaaagtcgcctatgtgctggtatccagcactcc
ttagaagaacttcaagaagaaggtcatacttgctatccgatagagctcctgatagatgtc
gtagccaaactattaaatcaagatgtctttgatactcctattactctcgaagaaatcgat
acgcaaatcctcaatatgcaaaagcgtaagcttttacatattcaagacatttctgggaca
ctccatgtctggacacgttatctccatctcgcagagaaaactattgtttctgatctcaag
cgcattttattttcttcgaggagaatccgttctatagacggagaaaaagcaattgcttgg
gtagaggaaaacctaagtatagatctcgcagaacaacaacgagaagcaattaaagcctgt
ttttctgaaaaacttctcatcattactgggggccctggaactggaaaaagtaccattacc
caagcaatactgaaaatttttgaacaggtgactcataaaatcatcctcgcagctcctaca
ggaaaagccgctaaacggatgaccgaaattacacaaaaacactcggtcaccattcatgct
ctgctacagtatgattttaaaacgaaatctttccgcaagaaccatgacaatcctatagac
tgtgatctgatcattgttgacgaatccggaatgatggacacgcacttgctgcaccacttc
ctgaaagcacttcctgactacacaactcttgtctttattggagacattcaccagctaccc
agcgtgggcccaggaaatatccttaaagacttgattacttcgaataaaatgacagtcatc
agattaaataagatcttccgccaagttcatgattcgggaatcgttacgaatgcccatagg
gtaaatgaaggggaactccccatattatattcagaaacagggcgtcgtgatttcttattt
ttccaaaaggatgatcaagaagaggctctcaatcatatcattcatcttgtgacaaaattc
gtcccacaaaaataccatatctatcctcaagatatccaagtactagctcccatgaaaaaa
ggaaccctaggaatctataatctaaataaagcactcaaacatgcattaaaccctaaaaaa
gcaaatcttcacggtagatttcaatcctatgccgttggcgataaggtaatgcaaatccgc
aacaactataataaagaagtctttaacggcgatataggctatgtctctacaatcaacttc
gaagataaagctgttgttgtccgtatggaaggaaagcatgtcggctattctttctcagag
cttgacgatctagtcttagcctatgctacctcagtacataagtaccagggaagtgaaagc
ccctgcattatcattcctattcatacctcgcactttatgatgctctatagaaatcttctc
tatactgctattacgcgggggaaaaaattggtgattctagttgggacaaaaaaagccatt
gctattgcaacaagaaataatcgagtgcaacaccgatgtacaggactagcagaagttctt
aaagagctcgatactaagaaaaattatgcagatctgtaa

DBGET integrated database retrieval system