KEGG   Chlamydia pneumoniae LPCoLN: CPK_ORF00713Help
Entry
CPK_ORF00713      CDS       T01859                                 

Definition
putative diphosphate--fructose-6-phosphate 1-phosphotransferase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
clp  Chlamydia pneumoniae LPCoLN
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:clp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPK_ORF00713
   01230 Biosynthesis of amino acids
    CPK_ORF00713
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPK_ORF00713
   00030 Pentose phosphate pathway
    CPK_ORF00713
   00051 Fructose and mannose metabolism
    CPK_ORF00713
   00052 Galactose metabolism
    CPK_ORF00713
  Energy metabolism
   00680 Methane metabolism
    CPK_ORF00713
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CPK_ORF00713
Enzymes [BR:clp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CPK_ORF00713
Protein phosphatases and associated proteins [BR:clp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CPK_ORF00713
Messenger RNA biogenesis [BR:clp03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CPK_ORF00713
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(595758..597410)
Genome map
AA seq 550 aa AA seqDB search
MHPSYFDLDTIISSYSPPLPKEFQEAASLIAVPDTSHSKPVVPGVKTLFPQTYHLPYLKF
VQGENVVHTPLKVGVMFSGGPAPGGHNVIQGLFNSLKDFHPDSSLVGFINNGDGLTNNKS
IDITEEFLSKFRNSGGFNCIGTGRKKIVTPEAKEACLKTAEALDLDGLVIIGGDGSNTAT
AILAEYFAKRRPKTSIVGVPKTIDGDLQHTFLDLTFGFDTATKFYSSIISNISRDALSCK
AHYHFIKLMGRSASHIALECALQTHPNIALIGEEIAEKNLPLKTIIHKICSVIADRAAME
KYYGVILIPEGIIEFIPEIINLITEIESLSEYEDKISRLSPESQRLLKSFPAPIIEQILN
DRDAHGNVYVSKISVDKLLIHLVSNHLQQYFPNVPFNAISHFLGYEGRSGLPTKFDNTYG
YSLGYGAGILVRNHCNGYLSTIESLACPFMKWKLRAIPVVKMFTVKQQADGTLQPKIKKY
LVDIGSTAFRKFKLYRKIWALEDSYRFLGPLQIETPPEMHSDNFPPLTLLLNHNFWQRHQ
GCIEIPDTTY
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgcatccttcatactttgatcttgatactattatcagctcctactctcctcccttacct
aaagaatttcaagaagcagcctctttaattgctgttccagatacttcacattctaagcct
gtcgttccaggagtgaaaaccctctttccacaaacctaccaccttccctatctaaagttt
gtccaaggagaaaatgtcgttcacactcctctaaaagtaggcgtaatgttctcaggagga
cctgctccaggaggacataatgtcatccaaggactcttcaatagtctaaaagatttccat
cccgattcctccctcgtggggttcataaataatggagacggtcttacaaacaataaaagc
atagacattactgaagagtttctctccaaattccgaaattccggaggcttcaactgtata
ggaacaggaaggaaaaaaattgtaactccagaagctaaagaggcttgtctaaagaccgca
gaggctctggatctcgacggactagtcattattggcggtgatggctccaatacagcaacc
gctattcttgcagagtattttgcaaaacgacgcccaaaaacctctattgtcggagttcct
aaaactatagatggggatctacaacacaccttcttggatctgacctttggatttgatact
gcaacaaaattctactcttcaatcattagcaatatttcaagagatgctctttcctgtaaa
gctcattaccacttcattaaacttatgggacgctcagcatcccatattgctttggaatgt
gctctccaaactcatccaaatattgcccttatcggcgaagaaattgccgaaaaaaatcta
ccactaaaaaccatcatccataaaatctgctccgtaattgcagatagagccgctatggaa
aaatactatggcgtcatcctcatcccagaaggcattatcgagttcatcccagaaatcatc
aacttaattacagaaatcgaaagcctatcagaatacgaagataaaatctccaggctctct
ccagaatcccaacgcctactgaaaagcttcccagcacctatcatcgagcaaatcctcaat
gaccgcgatgctcacggtaatgtctatgtttctaaaattagtgtcgacaaactactcatc
cacctggtcagcaatcatctccaacaatatttccctaacgtccctttcaatgcgatctca
cattttctaggatatgaaggacgctcgggattgcctacaaaattcgataatacctacggc
tatagcctcggatacggcgccggtattctcgtccgcaatcactgcaacggctatctctct
actatagaatccctagcatgccctttcatgaaatggaaattacgggcaattcccgtagtg
aaaatgttcacagtaaaacaacaggcagatggaactctacaacccaaaattaaaaaatac
ctcgtagatataggaagtacggcatttcgtaaatttaagctctataggaaaatttgggcc
ctcgaagactcctaccgattcctagggcctctacaaatagaaactcctccagaaatgcac
tctgataatttccctcctcttacccttttgcttaatcataacttttggcaacgtcaccag
ggctgcatagaaatccctgatactacgtattaa

DBGET integrated database retrieval system