KEGG   Chlamydia pneumoniae LPCoLN: CPK_ORF00835Help
Entry
CPK_ORF00835      CDS       T01859                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
clp  Chlamydia pneumoniae LPCoLN
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CPK_ORF00835 (malQ)
Enzymes [BR:clp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CPK_ORF00835 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(470369..471949)
Genome map
AA seq 526 aa AA seqDB search
MNVLKYTKHSSSAHAWKLIGTSPKHGIYLPLFSIHTKNSCGIGEFLDLVPLISWCQKQGF
GVIQLLPLNDTGEDTSPYNSISSVALNPLFLSLSSLPNIDTIPEVAKKLQDMHELCSTPS
VSYTQVKEKKWAFLREYYQKCCKSSLEGNSNFSEFLESERYWLYPYGTFRAIKHHMHGEP
INNWPKSLTDQENFPDLTKKFHDEVLFFSYLQFLCYQQLCEVKAYADQHHVLLKGDLPIL
ISKDSCDVWYFRDYFSSSRSVGAPPDLYNSEGQNWHLPIYNFSQLAKDDYIWWKERLRYA
QNFYSVYRLDHIIGFFRLWIWDSSGRGRFIPDNPKDYIKQGTEILSTMLGASSMLPIGED
LGIIPQDVKTTLTHLGICGTRIPRWERNWESDSAFIPLKDYNPLSVTTLSTHDSDTFAQW
WLNSPKEAKQFAKFLHLPFQKTLTTETQIDILKLSHESASIFHINLFNDYLALCPDLVSK
NLQRERINTPGTISKKNWSYRVRPSLEELAIHKKFNGYIEKILTGL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgttttaaaatacacaaaacactcatcctcagcacatgcttggaaacttatagga
acctctcctaaacacgggatttatctcccactattttcaatacacacaaaaaatagctgt
ggaatcggtgaatttttagatctcgttcctctgatctcttggtgccaaaaacagggcttc
ggcgttattcagcttctccctttaaatgatactggtgaagatacgagtccctataacagc
atctcttccgtagccctgaatcccctattcctttccctatcctctcttccaaatatcgat
accatccctgaagttgccaagaaacttcaagatatgcatgagttatgctcgactccatca
gtcagctatactcaagttaaagaaaaaaaatgggcattcttaagagagtactaccaaaaa
tgttgcaagtcttccctcgaaggaaactcgaatttttctgagtttctagaaagcgagcgc
tactggctttatccctatggaacctttcgtgcaatcaaacatcatatgcacggagaacct
attaataactggccgaagtcgctcacagatcaggagaattttccggacttaactaaaaaa
ttccatgatgaagtcctctttttttcctatctacagtttctctgttaccaacagctctgc
gaagtgaaagcctatgcagatcaacaccacgtcctgcttaaaggagacctccctattctt
attagcaaggatagctgtgatgtttggtatttccgagactacttttcttcatcaaggtct
gtaggagctcctcctgacctctacaattctgaaggacaaaactggcatctgcctatttat
aatttttcacaacttgccaaagacgactacatttggtggaaagagcgtctgcgatatgct
caaaacttctattccgtctatcgcttagatcatattataggatttttccgtttgtggatt
tgggattcttcaggaagaggaaggttcattccagacaatcctaaagactatataaagcag
ggcacggagattctttctactatgctcggagcctcttctatgttacctatcggagaagat
ttagggattataccccaagacgtcaaaacaacattaacacacttaggaatctgtggaacc
cggattccacgatgggaacgcaactgggaaagcgacagtgccttcattcccctaaaagat
tataatccactttctgtgaccactctctctacccacgactctgatacgtttgcccaatgg
tggctcaattcacctaaggaagctaagcaatttgctaaatttctacatcttccttttcaa
aaaaccctgactacagaaactcaaatagacatcttaaaactttctcatgaatcagcatct
atctttcatatcaacctctttaacgattacctcgccctctgccctgatttagtatcaaaa
aatctacaaagagaacgcattaatacacctgggacaatttctaaaaagaattggtcgtat
cgagttcggccttccttagaagaactcgctattcataaaaaatttaatggttacattgag
aagatccttacaggactgtaa

DBGET integrated database retrieval system