KEGG   Chlamydia pneumoniae LPCoLN: CPK_ORF00886Help
Entry
CPK_ORF00886      CDS       T01859                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
clp  Chlamydia pneumoniae LPCoLN
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:clp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPK_ORF00886 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPK_ORF00886 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    CPK_ORF00886 (sucB)
Enzymes [BR:clp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CPK_ORF00886 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
419465..420559
Genome map
AA seq 364 aa AA seqDB search
MTTEVRIPNIAESISEVTVASLLVTEGALIQENQGLLEIESDKVNQLIYAPASGRIFWEV
SEGDVVPVGGVVGKIEPAGEGEELGDSQSKETIEAEIICFPQSGVRQSPPENKTFIPLRD
QMDQGSQGLSAGDRGETRERMTSIRKTISRRLLSALHESAMLTTFNEVYMTPLLHLRKEK
QEEFLSRYGVKLGFMSFFVKAVLEALKAYPRVNAYIDGEEIVYRHYYDISIAVGTDRGLV
VPVIRDCDKLSNGEIEQKLADLALRAREGLLAIGELEGGGFTITNGGVYGSLLSTPIINP
PQVGILGMHKIEKRPVVLDNEIVIADMMYVALSYDHRLIDGKEAVGFLVKVKEDLENPTS
LLDL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgactacagaagtacgcattcctaatattgcagagtcgattagcgaggtgaccgtagct
tccttgttagttacagagggtgctctgattcaagaaaaccagggcttactagaaattgaa
agtgataaggtaaatcagctcatttatgccccagcatcgggaagaattttctgggaggtt
tcagaaggcgatgttgttcctgtagggggggtagtgggaaaaatagagcccgcaggtgaa
ggggaagagcttggagattctcagtctaaagagactatagaagctgagatcatttgcttt
cctcagtctggggtgcgtcagtctcctccagagaataaaacgtttattcctcttcgtgat
cagatggaccaaggatcccaaggtctttctgcaggagatcgaggagaaactcgagaacgt
atgacctcgattcgtaagacaatttcgcggcgtcttttgtctgctttacatgagtctgcg
atgctcacgacattcaatgaggtctatatgacgcctcttcttcatttgcgaaaggaaaaa
caagaagagtttctatctcgatatggggtgaagttaggatttatgtctttctttgtgaaa
gctgtcttagaggctttgaaggcatatccaagagtgaacgcctatattgatggtgaggag
attgtttaccgtcactattatgacatttctattgctgtaggtaccgatcgaggacttgtg
gttcctgtgatacgcgattgcgataaactttctaacggtgagatagagcagaaactcgcg
gatcttgcccttcgggctcgtgaaggcctacttgcaataggggagcttgagggaggaggt
ttcacaattaccaatggaggtgtatatggatcgctactttcgactcccattatcaatccc
ccgcaagtggggattttggggatgcataagatagaaaagcgccccgttgttcttgataat
gaaattgtaattgcagatatgatgtatgtcgctttaagctacgatcatcgccttattgat
gggaaagaggctgttgggtttttagtcaaagtgaaagaagacctagagaatcctacctca
ttactcgacttgtaa

DBGET integrated database retrieval system