KEGG   Chlamydia pneumoniae LPCoLN: CPK_ORF01036Help
Entry
CPK_ORF01036      CDS       T01859                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
clp  Chlamydia pneumoniae LPCoLN
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CPK_ORF01036 (hemD)
Enzymes [BR:clp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CPK_ORF01036 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(237499..238170)
Genome map
AA seq 223 aa AA seqDB search
MTLYLGLNQKTARKYQAHYLPILTLFPYAKSTPQNKRALQFLPQATHVILTSPSSTHLFL
SRMTSLLSKATLKTKTYLCIGESTKERLLSFLGQVKYAVATQEIAEGIFPLLQALPSSAR
ILYPHSSLARPVIREFLYNRFTFFSYPHYTVKPRKLKKNILSKYKEIIFTSPSTVRAFAK
IFPRFPEKTYWCQGRMTLQEFQKFYSQKQVSLLETLGKSRTSP
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaccctctacttaggattgaatcaaaaaaccgctcgtaaataccaagctcattatttg
cctattctaactctcttcccttatgcaaaaagcactccacaaaataagcgtgctcttcaa
ttccttccacaagcaacccatgtgattctcacaagtccctcatccactcacctattcctt
tccagaatgacttctcttctttctaaggccactctaaaaacaaagacctacctctgtata
ggagagtccaccaaagaaagacttctctctttccttggacaagtgaagtacgcagtagca
actcaagaaatcgctgaaggcatcttcccattgctacaggcactgccctcttcagcccgc
attctctacccccactcctccctcgcaagacctgtgatcagagaatttctttacaatcga
tttacttttttctcttaccctcactacacagtgaagccgcgaaaacttaaaaaaaatatt
ttatctaaatacaaagaaattatcttcacaagcccttcaactgtaagagctttcgccaaa
atctttccgcgatttcctgaaaaaacctactggtgccaaggaaggatgaccttgcaggag
tttcaaaagttctactctcaaaagcaggtatctttgttagaaacgcttgggaagtccagg
acatctccgtga

DBGET integrated database retrieval system