KEGG   Chlamydia pneumoniae LPCoLN: CPK_ORF01042Help
Entry
CPK_ORF01042      CDS       T01859                                 

Definition
2-oxo acid dehydrogenase acyltransferase family protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
clp  Chlamydia pneumoniae LPCoLN
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:clp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPK_ORF01042
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPK_ORF01042
  Amino acid metabolism
   00310 Lysine degradation
    CPK_ORF01042
Enzymes [BR:clp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CPK_ORF01042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
232253..233434
Genome map
AA seq 393 aa AA seqDB search
MIFEFRFPKIGETSSGGSIVRWLKNLGDHVARDEPLIEVSTDKIATELPSPKAGRLVRFC
VNEGDEVASGDVLGLIELEEISEADDESTSCPLTSCETKSEAGSSSSSAWFSPAVLSLAQ
REGIGLDNLQKIAGTGKGGRVTRQDLEAYISESQQVSIPETFQGEVNRIPMSPLRRAIAS
SLSKSSDEVPHASLVVDVDVTDLMNLISGERQRFLDTHGVKLTITSFIVQCLAQTLRQFP
LLNGSLDGTTIVMKKSVNVGVAVNLNKEGVVVPVIHNCQDRGLVSIAKALADLSSRARLN
KLDPSEVQDGSVTVTNFGMTGALIGMPIIRYPEVAILGIGTIQKRVVVRDDDSLAIRKMV
YVTLTFDHRVLDGIYGSEFLTSLKNRLESVTMG
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgatatttgagttccgattccctaaaataggagagacgagttccggaggatctatagtc
cgttggttaaaaaatttgggcgatcatgtagctagagatgagcctctgattgaagtatct
acggataaaattgctacagaattaccctctcctaaagcaggccgactggtgcgtttctgc
gtcaatgagggagacgaggttgcttctggggatgttttaggattgatagagcttgaggag
atttccgaagctgatgatgagagcacctcatgtcctctgacttcttgtgaaacaaagtcg
gaggcgggttccagcagttcttcggcatggttttctcctgccgtgctgagtttagctcaa
cgtgaaggcattggtcttgataacctccaaaagattgccggcacggggaaagggggacga
gtgactcgtcaagatttagaagcgtatatttcagaatcgcaacaagtttctattcccgaa
acatttcaaggagaagtgaatcgcattcctatgtctccgctacgtcgggcaatagcttct
tctctctccaagtcttcagatgaggttcctcacgcatctttggttgttgatgtcgatgtc
acagatcttatgaatctgatttctggtgaacgccaacgcttcttagatacgcatggggtg
aagctaacgattacaagtttcattgtacagtgtttagctcagactttaaggcagtttcct
ttattgaatggttccttagatgggactaccattgttatgaagaaatctgtgaatgtaggc
gttgccgtgaacctcaataaggaaggggttgttgttcctgtcatccacaattgtcaagat
cgcggtttagtaagtattgcaaaggccttggcggatctatcttcaagggctcggttaaat
aaattggatcctagtgaagtgcaagatggcagcgttactgtcacgaattttggaatgacg
ggagctttgattgggatgcccatcatacgttatcctgaagttgctattttaggaattggc
acaatacaaaaacgtgttgtcgtccgtgatgacgattctttagccattcgcaaaatggtc
tatgtgacacttacctttgaccatagagtattggatggtatttacggcagtgagttttta
acctcattgaaaaatcgtttggagtctgttacgatgggctaa

DBGET integrated database retrieval system