KEGG   Chlamydia pneumoniae LPCoLN: CPK_ORF01042Help
Entry
CPK_ORF01042      CDS       T01859                                 

Definition
2-oxo acid dehydrogenase acyltransferase family protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
clp  Chlamydia pneumoniae LPCoLN
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:clp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CPK_ORF01042
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPK_ORF01042
  Amino acid metabolism
   00310 Lysine degradation
    CPK_ORF01042
Enzymes [BR:clp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CPK_ORF01042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
232253..233434
Genome map
AA seq 393 aa AA seqDB search
MIFEFRFPKIGETSSGGSIVRWLKNLGDHVARDEPLIEVSTDKIATELPSPKAGRLVRFC
VNEGDEVASGDVLGLIELEEISEADDESTSCPLTSCETKSEAGSSSSSAWFSPAVLSLAQ
REGIGLDNLQKIAGTGKGGRVTRQDLEAYISESQQVSIPETFQGEVNRIPMSPLRRAIAS
SLSKSSDEVPHASLVVDVDVTDLMNLISGERQRFLDTHGVKLTITSFIVQCLAQTLRQFP
LLNGSLDGTTIVMKKSVNVGVAVNLNKEGVVVPVIHNCQDRGLVSIAKALADLSSRARLN
KLDPSEVQDGSVTVTNFGMTGALIGMPIIRYPEVAILGIGTIQKRVVVRDDDSLAIRKMV
YVTLTFDHRVLDGIYGSEFLTSLKNRLESVTMG
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgatatttgagttccgattccctaaaataggagagacgagttccggaggatctatagtc
cgttggttaaaaaatttgggcgatcatgtagctagagatgagcctctgattgaagtatct
acggataaaattgctacagaattaccctctcctaaagcaggccgactggtgcgtttctgc
gtcaatgagggagacgaggttgcttctggggatgttttaggattgatagagcttgaggag
atttccgaagctgatgatgagagcacctcatgtcctctgacttcttgtgaaacaaagtcg
gaggcgggttccagcagttcttcggcatggttttctcctgccgtgctgagtttagctcaa
cgtgaaggcattggtcttgataacctccaaaagattgccggcacggggaaagggggacga
gtgactcgtcaagatttagaagcgtatatttcagaatcgcaacaagtttctattcccgaa
acatttcaaggagaagtgaatcgcattcctatgtctccgctacgtcgggcaatagcttct
tctctctccaagtcttcagatgaggttcctcacgcatctttggttgttgatgtcgatgtc
acagatcttatgaatctgatttctggtgaacgccaacgcttcttagatacgcatggggtg
aagctaacgattacaagtttcattgtacagtgtttagctcagactttaaggcagtttcct
ttattgaatggttccttagatgggactaccattgttatgaagaaatctgtgaatgtaggc
gttgccgtgaacctcaataaggaaggggttgttgttcctgtcatccacaattgtcaagat
cgcggtttagtaagtattgcaaaggccttggcggatctatcttcaagggctcggttaaat
aaattggatcctagtgaagtgcaagatggcagcgttactgtcacgaattttggaatgacg
ggagctttgattgggatgcccatcatacgttatcctgaagttgctattttaggaattggc
acaatacaaaaacgtgttgtcgtccgtgatgacgattctttagccattcgcaaaatggtc
tatgtgacacttacctttgaccatagagtattggatggtatttacggcagtgagttttta
acctcattgaaaaatcgtttggagtctgttacgatgggctaa

DBGET integrated database retrieval system